Project name: f05 mutant 3 antibody

Status: done

Started: 2026-03-17 06:28:20
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:40)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/61a73fb0981c905/tmp/folded.pdb                (00:01:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:05)
Show buried residues

Minimal score value
-2.5847
Maximal score value
1.5494
Average score
-0.6769
Total score value
-167.1892

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.5064
2 I A 0.0000
3 V A 0.7269
4 L A 0.0000
5 T A -0.6275
6 K A -0.8314
7 S A -0.7879
8 P A -0.4319
9 A A -0.3884
10 T A -0.4975
11 L A -0.2931
12 S A -0.7028
13 L A -1.0251
14 S A -1.3501
15 P A -1.6031
16 G A -1.7466
17 E A -2.3371
18 R A -2.5534
19 A A 0.0000
20 T A -0.5316
21 L A 0.0000
22 S A -0.8665
23 C A 0.0000
24 R A -2.2603
25 V A 0.0000
26 S A -1.1838
27 Q A -2.3986
28 N A -2.5847
29 V A 0.0000
30 S A -1.2928
31 S A -1.0698
32 N A -1.4008
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.2744
40 P A -0.8610
41 G A -1.1861
42 Q A -1.5287
43 A A -1.1254
44 P A 0.0000
45 R A -1.3017
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A -1.0920
51 T A 0.0000
52 S A -1.1582
53 N A -1.3985
54 R A -1.8655
55 A A 0.0000
56 T A -0.7268
57 G A -0.7812
58 I A 0.0000
59 P A -0.5253
60 A A -0.4371
61 R A -0.8323
62 F A 0.0000
63 S A -0.7300
64 G A 0.0000
65 S A -0.7034
66 G A -0.8687
67 P A -0.9875
68 G A -1.4955
69 T A -1.8890
70 D A -1.9943
71 F A 0.0000
72 T A -0.7016
73 L A 0.0000
74 T A -0.5811
75 I A 0.0000
76 S A -1.3164
77 S A -1.6606
78 L A 0.0000
79 E A -1.9334
80 P A -1.7835
81 E A -2.5696
82 D A 0.0000
83 F A -0.8552
84 A A 0.0000
85 V A -0.2644
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A -1.0799
92 R A -2.3862
93 N A -1.5581
94 W A -0.5337
95 P A -0.8000
96 L A 0.0000
97 T A 0.0000
98 F A 0.1751
99 G A 0.0000
100 G A -0.6757
101 G A -0.7532
102 T A 0.0000
103 K A -1.0276
104 V A 0.0000
105 E A -0.8894
106 I A -0.7021
107 K A -1.8319
108 G A -1.4711
109 G A -1.2956
110 G A -1.1864
111 G A -1.2452
112 S A -1.0069
113 G A -1.5302
114 G A -1.5853
115 G A -1.7431
116 G A -1.7100
117 S A -1.3099
118 G A -1.4478
119 G A -1.2652
120 G A -1.4680
121 G A -1.6725
122 S A -1.7494
123 E A -2.4418
124 V A -1.5586
125 Q A -1.7476
126 L A 0.0000
127 V A 0.0460
128 E A 0.0000
129 S A -0.3987
130 G A -0.7786
131 G A 0.0749
132 G A 0.5854
133 L A 1.3089
134 V A 0.0000
135 Q A -1.4176
136 P A -1.6286
137 G A -1.4348
138 G A -0.9848
139 S A -1.3378
140 L A -1.1158
141 R A -2.2295
142 L A 0.0000
143 S A -0.5713
144 C A 0.0000
145 A A -0.4332
146 A A 0.0000
147 S A -1.0148
148 G A -1.3351
149 F A -0.8602
150 T A -0.7113
151 F A 0.0000
152 S A -1.5594
153 R A -1.9195
154 Y A -0.8668
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6523
162 A A -1.0567
163 P A -0.8433
164 G A -1.4543
165 K A -2.2486
166 G A -1.3273
167 L A 0.0000
168 E A -0.9293
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 S A 0.0000
173 I A 0.0000
174 S A -0.2150
175 A A -0.8651
176 S A -0.7798
177 G A -0.4279
178 A A -0.1305
179 T A -0.0349
180 T A 0.1368
181 Y A 0.0965
182 Y A -0.6066
183 A A 0.0000
184 D A -2.3603
185 P A -1.7661
186 V A 0.0000
187 K A -2.5296
188 G A -1.7128
189 R A -1.3039
190 F A 0.0000
191 T A -0.8641
192 I A 0.0000
193 S A -0.4185
194 R A -0.9264
195 D A -1.4657
196 N A -1.8349
197 S A -1.5506
198 K A -2.3378
199 N A -1.7197
200 T A -1.0661
201 L A 0.0000
202 Y A -0.5894
203 L A 0.0000
204 Q A -1.4887
205 M A 0.0000
206 N A -1.4673
207 S A -1.2377
208 L A 0.0000
209 R A -2.2284
210 A A -1.7056
211 E A -2.2168
212 D A 0.0000
213 T A -0.4032
214 A A 0.0000
215 V A 0.7169
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A -0.3480
222 Q A 0.0000
223 D A -0.6476
224 F A 0.2683
225 D A -0.5771
226 I A 1.2162
227 L A 0.8008
228 T A 0.4959
229 G A 0.4086
230 Y A 1.2530
231 L A 0.0000
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -0.7664
236 P A -0.9114
237 W A 0.0000
238 G A 0.0000
239 Q A -1.3673
240 G A 0.0000
241 T A 0.4286
242 L A 1.5494
243 V A 0.0000
244 T A 0.2738
245 V A 0.0000
246 S A -0.8069
247 S A -0.5915
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5253 3.6286 View CSV PDB
4.5 -0.5576 3.4308 View CSV PDB
5.0 -0.5966 3.1963 View CSV PDB
5.5 -0.6361 2.9462 View CSV PDB
6.0 -0.6686 2.6906 View CSV PDB
6.5 -0.6879 2.434 View CSV PDB
7.0 -0.6932 2.215 View CSV PDB
7.5 -0.6884 2.215 View CSV PDB
8.0 -0.6774 2.215 View CSV PDB
8.5 -0.6617 2.215 View CSV PDB
9.0 -0.6416 2.215 View CSV PDB