Project name: GFP_mut [mutate: VK11A, LK221A, YK39A]

Status: done

Started: 2024-03-11 09:10:12
Chain sequence(s) A: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTTTVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues YK39A,VK11A,LK221A
Energy difference between WT (input) and mutated protein (by FoldX) -0.229812 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:01:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:01:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:01:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:01:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:01:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:06:08)
[INFO]       FoldX:    Building mutant model                                                       (00:10:49)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:12:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:12:16)
Show buried residues

Minimal score value
-4.216
Maximal score value
0.1405
Average score
-1.1354
Total score value
-256.6008

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
3 K A -2.4336
4 G A 0.0000
5 E A -2.4002
6 E A -2.4756
7 L A -1.2574
8 F A 0.0000
9 T A -1.2525
10 G A -1.4713
11 K A -2.4001 mutated: VK11A
12 V A 0.0000
13 P A -1.7278
14 I A 0.0000
15 L A -1.3270
16 V A 0.0000
17 E A -2.5537
18 L A 0.0000
19 D A -3.5794
20 G A 0.0000
21 D A -2.8287
22 V A 0.0000
23 N A -2.1384
24 G A -1.7489
25 H A -2.3107
26 K A -3.0339
27 F A 0.0000
28 S A -1.8958
29 V A 0.0000
30 S A -1.2551
31 G A 0.0000
32 E A -2.3033
33 G A -1.7189
34 E A -2.3051
35 G A 0.0000
36 D A -1.9891
37 A A 0.0000
38 T A -1.7572
39 K A -2.3421 mutated: YK39A
40 G A 0.0000
41 K A -1.8336
42 L A 0.0000
43 T A -1.3386
44 L A 0.0000
45 K A -1.4829
46 F A 0.0000
47 I A -0.9674
48 C A 0.0000
49 T A -1.0388
50 T A -1.3307
51 G A -1.6443
52 K A -2.2753
53 L A 0.0000
54 P A -1.2457
55 V A 0.0000
56 P A -0.7489
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A -0.0001
63 T A 0.0000
64 L A 0.0000
68 V A 0.0030
69 Q A -0.1839
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -2.0689
74 Y A 0.0000
75 P A -1.9148
76 D A -2.8557
77 H A -2.1443
78 M A 0.0000
79 K A -2.8430
80 R A -2.8515
81 H A -1.7268
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -1.1974
87 A A 0.0000
88 M A 0.0000
89 P A -1.6059
90 E A -2.1584
91 G A 0.0000
92 Y A 0.0000
93 V A -0.7676
94 Q A 0.0000
95 E A -2.2978
96 R A 0.0000
97 T A -1.0357
98 I A 0.0000
99 S A -1.2772
100 F A 0.0000
101 K A -2.5200
102 D A -2.9225
103 D A -2.8662
104 G A 0.0000
105 N A -1.5582
106 Y A 0.0000
107 K A -2.5103
108 T A 0.0000
109 R A -3.3411
110 A A 0.0000
111 E A -2.2234
112 V A 0.0000
113 K A -1.6465
114 F A -1.8885
115 E A -2.6978
116 G A -2.2660
117 D A -2.3940
118 T A -1.9331
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -3.2473
123 I A 0.0000
124 E A -4.2160
125 L A 0.0000
126 K A -3.0971
127 G A 0.0000
128 I A -1.2638
129 D A -2.2926
130 F A 0.0000
131 K A -3.9588
132 E A -4.0000
133 D A -3.6505
134 G A -2.8598
135 N A -2.3198
136 I A 0.0000
137 L A -2.0519
138 G A -2.3805
139 H A -2.2785
140 K A -2.6063
141 L A -1.9389
142 E A -2.4041
143 Y A -1.0353
144 N A -0.7111
145 Y A -0.7999
146 N A -1.0043
147 S A -0.9958
148 H A 0.0000
149 N A -1.4579
150 V A 0.0000
151 Y A -0.0378
152 I A 0.0000
153 T A -1.1414
154 A A -1.7187
155 D A -2.2308
156 K A -3.2066
157 Q A -3.1688
158 K A -3.2478
159 N A -2.8733
160 G A 0.0000
161 I A 0.0000
162 K A -1.0662
163 A A 0.0000
164 N A -1.2525
165 F A 0.0000
166 K A -1.7957
167 I A 0.0000
168 R A -1.1128
169 H A 0.0000
170 N A -1.4386
171 I A 0.0000
172 E A -3.4518
173 D A -3.0614
174 G A -1.8692
175 S A -0.7908
176 V A 0.1405
177 Q A 0.0000
178 L A -0.8987
179 A A 0.0000
180 D A -1.4265
181 H A 0.0000
182 Y A -0.3334
183 Q A 0.0000
184 Q A -1.0804
185 N A 0.0000
186 T A -0.7355
187 P A -0.8271
188 I A -0.2234
189 G A -1.2460
190 D A -2.0978
191 G A -1.4762
192 P A -0.8002
193 V A -0.1090
194 L A -0.2339
195 L A -0.6331
196 P A 0.0000
197 D A -2.4700
198 N A -1.8735
199 H A 0.0000
200 Y A -0.3092
201 L A 0.0000
202 S A -0.6246
203 T A -0.7787
204 Q A -1.3891
205 S A -0.9143
206 A A -0.5434
207 L A -0.5349
208 S A -1.0255
209 K A -2.0140
210 D A -2.1565
211 P A -1.8268
212 N A -2.4818
213 E A -2.7197
214 K A -3.3442
215 R A -3.3788
216 D A -2.2940
217 H A 0.0000
218 M A 0.0000
219 V A -0.8705
220 L A 0.0000
221 K A -1.3211 mutated: LK221A
222 E A -0.7984
223 F A -0.2541
224 V A 0.0000
225 T A -0.8502
226 A A 0.0000
227 A A -0.4296
228 G A -0.6645
229 I A -0.7235
230 T A -0.5736
231 H A -1.3156
Download PDB file
View in 3Dmol