Project name: 6328bbaddefe3a0

Status: done

Started: 2026-06-15 16:31:42
Chain sequence(s) A: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6328bbaddefe3a0/tmp/folded.pdb                (00:05:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:00)
Show buried residues

Minimal score value
-3.7588
Maximal score value
1.7073
Average score
-1.2994
Total score value
-362.5316

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.2508
2 T A -0.8601
3 E A -2.3438
4 R A -2.3511
5 F A -1.1565
6 D A -1.7259
7 C A 0.0000
8 H A -1.8213
9 H A -1.1629
10 C A -1.3163
11 N A -2.7423
12 E A -2.5850
13 S A -1.4259
14 L A 0.0000
15 F A 0.6796
16 G A -0.5395
17 K A -1.8926
18 K A -1.4553
19 Y A 0.5409
20 I A 1.0317
21 L A 0.3123
22 R A -1.4268
23 E A -2.8027
24 E A -2.5386
25 S A -1.6605
26 P A -0.4744
27 Y A 0.0000
28 C A 0.0000
29 V A 1.2396
30 V A 1.7073
31 C A 0.0000
32 F A 1.4350
33 E A 0.3069
34 T A -0.1001
35 L A 1.2685
36 F A 1.5417
37 A A 0.4178
38 N A -1.2000
39 T A -1.4732
40 C A 0.0000
41 E A -2.5355
42 E A -2.0414
43 C A -1.0775
44 G A -1.8025
45 K A -2.3922
46 P A -1.6996
47 I A 0.0000
48 G A -1.2693
49 C A -0.7401
50 D A -1.8817
51 C A -1.9100
52 K A -2.7967
53 D A -2.5520
54 L A -1.5676
55 S A -1.5410
56 Y A -1.4041
57 K A -2.5379
58 D A -2.3053
59 R A -2.6371
60 H A -2.3392
61 W A 0.0000
62 H A -2.1106
63 E A -2.0648
64 A A -1.2460
65 C A -1.0384
66 F A 0.0000
67 H A -1.6329
68 C A 0.0000
69 S A -1.8515
70 Q A -1.8914
71 C A -1.5634
72 R A -2.6119
73 N A -2.2197
74 S A -1.7251
75 L A 0.0000
76 V A -1.4761
77 D A -2.2449
78 K A -1.9983
79 P A -1.0787
80 F A -0.2455
81 A A -0.5519
82 A A -1.3982
83 K A -2.8008
84 E A -3.5882
85 D A -3.7588
86 Q A -3.0560
87 L A 0.0000
88 L A -1.0104
89 C A -1.0742
90 T A -1.0389
91 D A -2.1376
92 C A -1.1295
93 Y A -0.6434
94 S A -1.0654
95 N A -2.4124
96 E A -1.9160
97 Y A -0.1521
98 S A -0.9023
99 S A -1.6165
100 K A -3.0727
101 C A 0.0000
102 Q A -2.8222
103 E A -2.6079
104 C A -2.2726
105 K A -3.6087
106 K A -3.2285
107 T A -1.8131
108 I A 0.0000
109 M A 0.0291
110 P A -0.2557
111 G A -0.9369
112 T A -1.3583
113 R A -2.8193
114 K A -2.7592
115 M A -1.8852
116 E A -2.6574
117 Y A -1.3487
118 K A -2.0950
119 G A -1.6442
120 S A -1.7567
121 S A -2.3510
122 W A 0.0000
123 H A -2.2604
124 E A -1.7269
125 T A -1.1212
126 C A -0.9640
127 F A 0.0000
128 I A -1.0539
129 C A 0.0000
130 H A -1.9377
131 R A -1.7825
132 C A -1.1326
133 Q A -1.9926
134 Q A -1.8368
135 P A -1.1900
136 I A 0.0000
137 G A -0.9504
138 T A -0.8568
139 K A -1.4313
140 S A -0.5619
141 F A 0.1212
142 I A 0.0394
143 P A -1.2371
144 K A -2.6265
145 D A -3.1718
146 N A -2.8394
147 Q A -2.4478
148 N A -1.3262
149 F A 0.0000
150 C A -0.5196
151 V A -0.2981
152 P A -1.0631
153 C A -1.4391
154 Y A -1.9326
155 E A -3.0621
156 K A -3.2968
157 Q A -3.0287
158 H A -2.7599
159 A A -2.0657
160 M A -1.4278
161 Q A -2.3680
162 C A 0.0000
163 V A -1.2775
164 Q A -2.0163
165 C A -1.8485
166 K A -3.0113
167 K A -2.9614
168 P A -1.9215
169 I A -0.9901
170 T A -0.6699
171 T A -0.4681
172 G A -0.7428
173 G A -1.0075
174 V A -0.7718
175 T A -1.1296
176 Y A -1.3214
177 R A -2.7612
178 E A -2.7718
179 Q A -1.9709
180 P A -1.3603
181 W A -1.4887
182 H A -2.0205
183 K A -2.2835
184 E A -3.0546
185 C A -1.8595
186 F A 0.0000
187 V A -1.5784
188 C A 0.0000
189 T A -0.0923
190 A A -0.3310
191 C A -0.9298
192 R A -2.5089
193 K A -2.6348
194 Q A -2.6445
195 L A 0.0000
196 S A -1.7203
197 G A -1.5110
198 Q A -2.1945
199 R A -2.2643
200 F A -0.8581
201 T A 0.0000
202 A A -1.0452
203 R A -2.6744
204 D A -2.9355
205 D A -2.4888
206 F A -0.2116
207 A A 0.0000
208 Y A -0.4138
209 C A 0.0000
210 L A -0.7360
211 N A -1.2382
212 C A -0.2960
213 F A 0.0000
214 C A -0.2700
215 D A -0.8774
216 L A 0.9736
217 Y A 1.2799
218 A A -0.2922
219 K A -1.3905
220 K A -2.4076
221 C A 0.0000
222 A A -1.5645
223 G A -1.5815
224 C A -0.8707
225 T A -1.3838
226 N A -1.9199
227 P A -1.5049
228 I A 0.0000
229 S A -1.1532
230 G A -1.1182
231 L A -0.8446
232 G A -0.8345
233 G A -1.1200
234 T A -1.2261
235 K A -1.7521
236 Y A -0.5458
237 I A -0.1132
238 S A -0.8259
239 F A -0.8585
240 E A -2.5667
241 E A -2.7607
242 R A -2.2614
243 Q A -1.4093
244 W A 0.0000
245 H A -1.3553
246 N A -1.2468
247 D A -1.8294
248 C A -0.9598
249 F A 0.0000
250 N A -1.1754
251 C A 0.0000
252 K A -2.8221
253 K A -2.5059
254 C A -0.9165
255 S A -0.7442
256 L A -0.1003
257 S A -0.6771
258 L A 0.0000
259 V A -0.4367
260 G A -1.0857
261 R A -1.9663
262 G A -1.1005
263 F A -0.2834
264 L A -0.1877
265 T A -1.0763
266 E A -2.4031
267 R A -3.4584
268 D A -3.5734
269 D A -3.1424
270 I A 0.0000
271 L A 0.0000
272 C A 0.0000
273 P A -1.5887
274 D A -2.6222
275 C A -1.7419
276 G A 0.0000
277 K A -2.4890
278 D A -1.8935
279 I A 0.4843
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.1291 3.246 View CSV PDB
4.5 -1.229 3.1895 View CSV PDB
5.0 -1.3489 3.1167 View CSV PDB
5.5 -1.4631 3.0369 View CSV PDB
6.0 -1.5461 2.9555 View CSV PDB
6.5 -1.582 2.8741 View CSV PDB
7.0 -1.5714 2.7993 View CSV PDB
7.5 -1.5285 2.7381 View CSV PDB
8.0 -1.4672 2.6893 View CSV PDB
8.5 -1.3927 2.8053 View CSV PDB
9.0 -1.3035 3.0141 View CSV PDB