Project name: 6351b8e524d7ea6

Status: done

Started: 2026-07-09 05:29:55
Chain sequence(s) B: AVQLVESGGGLVQPGGSLRLSCTASGSILSFNSMGWHRQAPGRQRELVAGISIHKTSSNYANFVKGRFTISRDDAKNTVYLQMNSLKPEDTAVYYCAAVQRYQRRISYWGQGTQVTVSS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:56)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6351b8e524d7ea6/tmp/folded.pdb                (00:04:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:45)
Show buried residues

Minimal score value
-3.025
Maximal score value
2.4254
Average score
-0.36
Total score value
-42.8428

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A B 1.2221
2 V B 1.7349
3 Q B 0.7069
4 L B 1.0529
5 V B 0.7299
6 E B -0.4913
7 S B -0.5242
8 G B -0.6126
9 G B -1.1329
10 G B -1.0616
11 L B -0.5009
12 V B -0.6715
13 Q B -1.5787
14 P B -1.1836
15 G B -1.2037
16 G B -1.2292
17 S B -0.7157
18 L B -0.4867
19 R B -1.2288
20 L B -0.0730
21 S B 0.0231
22 C B 0.1974
23 T B 0.2081
24 A B 0.2997
25 S B 0.4551
26 G B 0.6031
27 S B 0.9454
28 I B 1.8053
29 L B 2.0639
30 S B 1.8759
31 F B 2.4254
32 N B 1.2842
33 S B 0.8476
34 M B 0.7427
35 G B 0.0379
36 W B -0.2150
37 H B -1.1701
38 R B -2.0891
39 Q B -2.1450
40 A B -2.0311
41 P B -2.2406
42 G B -2.6023
43 R B -3.0250
44 Q B -2.4283
45 R B -2.1821
46 E B -1.7344
47 L B -0.3006
48 V B 0.2056
49 A B 0.0609
50 G B 0.4280
51 I B 1.0719
52 S B 0.4545
53 I B 0.2895
54 H B -0.5026
55 K B -0.8783
56 T B -0.4776
57 S B -0.2025
58 S B -0.2986
59 N B -0.0095
60 Y B 0.9628
61 A B 0.3389
62 N B 0.1429
63 F B 0.7568
64 V B 0.4338
65 K B -0.5834
66 G B -0.6908
67 R B -1.3759
68 F B -0.6922
69 T B -0.8752
70 I B -0.9853
71 S B -1.8525
72 R B -2.8983
73 D B -2.8960
74 D B -2.4082
75 A B -2.0376
76 K B -2.1789
77 N B -1.6756
78 T B -0.8638
79 V B 0.0120
80 Y B 0.7563
81 L B 0.3141
82 Q B -0.3078
83 M B -0.3446
84 N B -1.3882
85 S B -1.3428
86 L B -1.5763
87 K B -2.7116
88 P B -2.1407
89 E B -2.0273
90 D B -1.8122
91 T B -0.5945
92 A B 0.1078
93 V B 0.8224
94 Y B 1.8270
95 Y B 1.8745
96 C B 1.5485
97 A B 1.1989
98 A B 0.9282
99 V B 0.6539
100 Q B -0.3807
101 R B -0.8547
102 Y B -0.4037
103 Q B -0.8942
104 R B -1.4226
105 R B -1.0156
106 I B -0.2664
107 S B -0.3092
108 Y B 0.0348
109 W B 0.3530
110 G B -0.4165
111 Q B -0.6592
112 G B -0.2907
113 T B -0.1659
114 Q B -0.1866
115 V B 0.5645
116 T B 0.5471
117 V B 1.0722
118 S B 0.5530
119 S B 0.3347
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.2197 4.6882 View CSV PDB
4.5 -0.2493 4.6897 View CSV PDB
5.0 -0.287 4.6937 View CSV PDB
5.5 -0.3206 4.703 View CSV PDB
6.0 -0.3371 4.7188 View CSV PDB
6.5 -0.3336 4.7358 View CSV PDB
7.0 -0.3164 4.7475 View CSV PDB
7.5 -0.293 4.753 View CSV PDB
8.0 -0.2673 4.755 View CSV PDB
8.5 -0.2398 4.7557 View CSV PDB
9.0 -0.2106 4.7559 View CSV PDB