Project name: AAVA_R3

Status: done

Started: 2026-08-21 04:28:37
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:00)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/637f1cad668eb11/tmp/folded.pdb                (00:02:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:19)
Show buried residues

Minimal score value
-2.7488
Maximal score value
1.8848
Average score
-0.5525
Total score value
-137.0116

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6089
2 V A -1.3063
3 Q A -1.9718
4 L A 0.0000
5 Q A -1.8557
6 E A 0.0000
7 S A -0.6203
8 G A -0.3601
9 P A -0.0504
10 G A 0.2754
11 L A 0.5626
12 V A 0.0000
13 K A -1.6480
14 P A -1.2914
15 S A -1.3768
16 Q A -1.8628
17 T A -1.6178
18 L A 0.0000
19 S A -1.0074
20 L A 0.0000
21 T A -0.6304
22 A A 0.0000
23 T A -1.2466
24 V A 0.0000
25 S A -1.3366
26 G A -1.3448
27 G A -1.0349
28 S A -0.6383
29 I A 0.0000
30 S A -0.2203
31 S A -0.2951
32 G A -0.0576
33 D A -0.0384
34 Y A 0.5492
35 Y A 0.6056
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6790
43 P A -0.6767
44 G A -1.1791
45 C A -1.2588
46 K A -2.0505
47 G A -1.2342
48 L A 0.0000
49 E A -0.7270
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1885
54 I A 0.0000
55 Y A 0.3805
56 Y A 0.3733
57 S A -0.0593
58 G A -0.2221
59 S A -0.2054
60 T A -0.1695
61 D A -0.5785
62 Y A -0.7354
63 N A -0.9836
64 P A -1.3438
65 S A -1.2086
66 L A 0.0000
67 K A -2.1410
68 S A -1.4725
69 R A -1.7237
70 V A 0.0000
71 T A -1.1326
72 M A 0.0000
73 S A -0.3999
74 V A -0.3689
75 D A -1.2177
76 T A -1.0512
77 S A -1.3499
78 K A -2.1810
79 N A -1.4508
80 Q A -1.2754
81 F A 0.0000
82 S A -0.5647
83 L A 0.0000
84 K A -1.6873
85 V A 0.0000
86 N A -1.9026
87 S A -1.5615
88 V A 0.0000
89 T A -0.6631
90 A A -0.2724
91 A A -0.0953
92 D A 0.0000
93 T A 0.2960
94 A A 0.0000
95 V A 0.4347
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.6110
103 I A 1.3513
104 F A 1.8848
105 G A 0.6388
106 V A 0.4425
107 G A 0.5664
108 T A 0.0000
109 F A 0.0000
110 D A -0.5758
111 Y A -0.5736
112 W A -0.8211
113 G A 0.0000
114 Q A -1.5690
115 G A -0.6146
116 T A 0.0893
117 L A 1.3312
118 V A 0.0000
119 T A 0.2986
120 V A 0.0000
121 S A -0.3715
122 S A -0.6979
123 A A -0.4862
124 A A -0.3668
125 G A -0.8391
126 G A -1.0819
127 G A -1.1495
128 G A -1.1734
129 S A -1.0098
130 G A -1.1735
131 G A -1.1730
132 G A -1.1656
133 G A -1.1604
134 S A -1.0195
135 G A -1.1613
136 G A -1.2273
137 G A -1.2704
138 G A -1.2706
139 S A -0.8784
140 D A -0.8579
141 I A -0.1194
142 V A 0.9949
143 M A 0.0000
144 T A -0.5700
145 Q A -0.6661
146 S A -0.7342
147 P A -0.3260
148 A A -0.3352
149 T A -0.4376
150 L A -0.1858
151 S A -0.3433
152 L A -0.6633
153 S A -0.9791
154 P A -1.4696
155 G A -1.8437
156 E A -2.4475
157 R A -2.7488
158 A A 0.0000
159 T A -0.6503
160 L A 0.0000
161 S A -0.8731
162 V A 0.0000
163 R A -2.2816
164 A A 0.0000
165 S A -0.8445
166 Q A -1.5662
167 S A -1.2315
168 V A 0.0000
169 S A -0.5377
170 S A -0.3353
171 Y A 0.5728
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3940
179 P A -0.8518
180 G A -0.9537
181 C A -1.1157
182 Q A -1.5162
183 A A -1.1733
184 P A 0.0000
185 R A -1.6032
186 L A -0.8089
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5115
190 D A -0.7442
191 A A 0.0000
192 S A -1.1780
193 N A -1.7080
194 R A -1.7160
195 A A -1.0528
196 T A -0.6467
197 G A -0.6517
198 I A 0.0000
199 P A -0.4435
200 A A -0.4149
201 R A -0.7937
202 F A 0.0000
203 S A -0.7828
204 G A -0.8318
205 S A -0.8664
206 G A -1.1296
207 S A -0.7749
208 G A -1.0499
209 T A -1.7190
210 D A -2.0853
211 F A 0.0000
212 T A -0.7571
213 L A 0.0000
214 T A -0.6318
215 I A 0.0000
216 S A -1.5138
217 S A -1.8434
218 L A 0.0000
219 E A -2.1971
220 P A -1.3475
221 E A -2.0445
222 D A 0.0000
223 F A -0.6118
224 A A 0.0000
225 V A -0.5630
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1498
233 S A -0.2907
234 T A -0.4277
235 P A -0.5213
236 L A 0.0000
237 T A 0.1221
238 F A 0.2505
239 G A 0.0000
240 G A -0.7934
241 G A -0.7556
242 T A 0.0000
243 K A -0.7595
244 A A 0.0000
245 E A -0.4463
246 I A 0.7064
247 K A -0.8924
248 A A -0.3522
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5015 4.7684 View CSV PDB
4.5 -0.5241 4.7271 View CSV PDB
5.0 -0.5498 4.6771 View CSV PDB
5.5 -0.5729 4.6235 View CSV PDB
6.0 -0.587 4.5687 View CSV PDB
6.5 -0.5875 4.5136 View CSV PDB
7.0 -0.5751 4.4584 View CSV PDB
7.5 -0.5543 4.4038 View CSV PDB
8.0 -0.5287 4.3507 View CSV PDB
8.5 -0.4995 4.3019 View CSV PDB
9.0 -0.4667 4.263 View CSV PDB