Project name: 658830415a8310b

Status: done

Started: 2026-06-26 06:23:08
Chain sequence(s) A: RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
B: MRLRKLPDSFFKPP
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:39)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/658830415a8310b/tmp/folded.pdb                (00:03:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:03)
Show buried residues

Minimal score value
-3.3969
Maximal score value
2.4003
Average score
-0.7036
Total score value
-163.2251

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
217 R A -2.1290
218 S A -0.9650
219 V A 0.0000
220 A A -0.7882
221 S A 0.0000
222 S A -0.9027
223 K A -1.5024
224 L A 0.0000
225 W A -0.6251
226 M A 0.0000
227 L A -0.7939
228 E A -1.0564
229 F A -0.3488
230 S A -0.2976
231 A A 0.0512
232 F A 0.0000
233 L A 0.0000
234 E A -1.3698
235 Q A -1.6126
236 Q A -2.0467
237 Q A -2.3680
238 D A -2.1007
239 P A -1.6374
240 D A -2.1620
241 T A -1.2472
242 Y A -0.7556
243 N A -1.5363
244 K A -1.7214
245 H A -1.0752
246 L A -0.0587
247 F A 0.0000
248 V A 0.0000
249 H A -0.6359
250 I A 0.0000
251 G A -1.5029
252 Q A -1.9404
253 S A -1.2946
254 S A -0.9269
255 P A -0.6243
256 S A -0.1516
257 Y A 0.5788
258 S A -0.4210
259 D A -1.3569
260 P A -0.6720
261 Y A 0.5774
262 L A 0.3592
263 E A -0.2084
264 A A -0.3823
265 V A 0.0000
266 D A 0.0000
267 I A 0.0000
268 R A -2.8314
269 Q A -2.3100
270 I A 0.0000
271 Y A -1.8263
272 D A -2.4226
273 K A -1.3274
274 F A 0.0000
275 P A -2.0492
276 E A -2.8746
277 K A -3.3119
278 K A -3.1202
279 G A -2.1678
280 G A 0.0000
281 L A 0.0000
282 K A -3.2733
283 D A -3.1167
284 L A -2.1356
285 F A 0.0000
286 E A -3.3969
287 R A -3.0197
288 G A -1.9825
289 P A -1.3051
290 S A -1.3149
291 N A -0.7911
292 A A 0.0000
293 F A 0.0000
294 F A 0.0000
295 L A 0.0000
296 V A 0.0000
297 K A 0.0000
298 F A 0.0000
299 W A -0.2348
300 A A 0.0000
301 D A 0.0000
302 L A 0.0000
303 N A -1.1477
304 T A -1.3059
305 N A -1.3221
306 I A -0.2105
307 E A -2.1318
308 D A -1.5996
309 E A -1.7117
310 G A -1.8213
311 S A -1.1752
312 S A -0.8910
313 F A -0.1598
314 Y A 0.0000
315 G A 0.0000
316 V A -0.1996
317 S A -0.9891
318 S A 0.0000
319 Q A -1.1517
320 Y A 0.0000
321 E A 0.0000
322 S A 0.0000
323 P A -1.3447
324 E A -2.0687
325 N A -1.8196
326 M A 0.0000
327 I A -0.3524
328 I A 0.0000
329 T A -0.2235
330 C A 0.0000
331 S A 0.2991
332 T A 0.0235
333 K A -0.3472
334 V A 0.0000
335 C A 0.0000
336 S A 0.0000
337 F A 0.7980
338 G A 0.0000
339 K A -1.6529
340 Q A -0.5889
341 V A 0.5439
342 V A -0.0025
343 E A -0.2206
344 K A 0.1159
345 V A 1.1996
346 E A 0.3251
347 T A 0.0471
348 E A -0.3668
349 Y A 0.4965
350 A A -0.8313
351 R A -1.5836
352 Y A -0.6251
353 E A -1.4176
354 N A -1.6553
355 G A -1.1785
356 H A -1.5421
357 Y A -1.1080
358 S A -1.2256
359 Y A 0.0000
360 R A -2.2996
361 I A -1.4595
362 H A -1.7372
363 R A -1.2699
364 S A -0.6444
365 P A -0.5995
366 L A 0.0000
367 C A -0.7143
368 E A -1.5596
369 Y A -0.2392
370 M A -0.2184
371 I A -0.5953
372 N A -1.4088
373 F A -0.8331
374 I A -0.9934
375 H A -1.5961
376 K A -2.3914
377 L A 0.0000
378 K A -1.9495
379 H A -1.9146
380 L A -1.1033
381 P A -1.0371
382 E A -1.4959
383 K A -0.4431
384 Y A 0.8820
385 M A 0.5126
386 M A 0.0000
387 N A 0.0000
388 S A 0.3363
389 V A 0.8246
390 L A 0.0000
391 E A -0.4766
392 N A -0.6534
393 F A 0.0000
394 T A 0.0000
395 I A 0.0000
396 L A 0.0000
397 Q A 0.0000
398 V A 0.0000
399 V A 0.0000
400 T A -1.0632
401 N A 0.0000
402 R A -2.2215
403 D A -2.6466
404 T A -1.9601
405 Q A -2.4239
406 E A -2.1572
407 T A 0.0000
408 L A 0.0000
409 L A 0.0000
410 C A 0.0000
411 I A 0.0000
412 A A 0.0000
413 Y A 0.0000
414 V A 0.0000
415 F A 0.0134
416 E A 0.0000
417 V A 0.0000
418 S A 0.0000
419 A A -0.8448
420 S A -1.5419
421 E A -2.4638
422 H A -2.1330
423 G A -1.5331
424 A A 0.0000
425 Q A -1.5783
426 H A -0.7683
427 H A -0.4415
428 I A -0.1100
429 Y A 0.0000
430 R A -0.3204
431 L A 0.0000
432 V A -1.4642
433 K A -3.0267
434 E A -2.9049
1 M B -0.1574
2 R B -0.0884
3 L B 1.0406
4 R B -0.0640
5 K B 0.0000
6 L B 1.1821
7 P B 1.1069
8 D B 0.0000
9 S B 0.8215
10 F B 2.4003
11 F B 2.1082
12 K B -0.1747
13 P B -0.1427
14 P B -0.0033
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5738 5.9697 View CSV PDB
4.5 -0.6324 5.977 View CSV PDB
5.0 -0.704 5.9977 View CSV PDB
5.5 -0.7728 6.046 View CSV PDB
6.0 -0.8221 6.1313 View CSV PDB
6.5 -0.8417 6.2448 View CSV PDB
7.0 -0.835 6.3721 View CSV PDB
7.5 -0.813 6.5044 View CSV PDB
8.0 -0.7835 6.6381 View CSV PDB
8.5 -0.7489 6.771 View CSV PDB
9.0 -0.7092 6.9003 View CSV PDB