Project name: phlamhtrimer [mutate: LR73C, FH74D] [mutate: LR40B]

Status: done

Started: 2025-07-30 16:04:52
Chain sequence(s) C: DARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCR
B: ENVERWQGQYEGLRGQDLGQAVLDAGHSVSTLEKTLPQLLAKLSILENRGVHNASLALSASIGRVRELCAQARGAASKVKV
D: DTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRDIEEIMKCIRNLEDIRKTLPSGCHNTPSIEKP
input PDB
Selected Chain(s) B,C,D
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues LR40B
Energy difference between WT (input) and mutated protein (by FoldX) 1.33976 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:04:59)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:18)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/66cf301656e66/tmp/folded.pdb                  (00:05:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:46)
Show buried residues

Minimal score value
-4.3737
Maximal score value
1.2407
Average score
-1.5903
Total score value
-375.3083

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E B -2.8742
2 N B -2.3304
3 V B -0.8251
4 E B -2.9710
5 R B -3.2802
6 W B -1.2863
7 Q B -1.9316
8 G B -2.4558
9 Q B -2.0406
10 Y B -1.5815
11 E B -2.8458
12 G B -1.9186
13 L B -0.9570
14 R B -2.5854
15 G B -2.7059
16 Q B -2.2811
17 D B -2.2820
18 L B -2.3506
19 G B -1.3671
20 Q B -1.7488
21 A B 0.0000
22 V B 0.0000
23 L B -0.1431
24 D B -1.2138
25 A B 0.0000
26 G B -1.0514
27 H B -1.3474
28 S B -1.4552
29 V B 0.0000
30 S B -1.3337
31 T B -1.4037
32 L B 0.0000
33 E B -2.2803
34 K B -2.3503
35 T B -1.5924
36 L B 0.0000
37 P B -1.4491
38 Q B -1.6255
39 L B 0.0000
40 R B -0.7703 mutated: LR40B
41 A B -0.3963
42 K B -0.6801
43 L B 0.0000
44 S B -0.4938
45 I B 0.5977
46 L B 0.0000
47 E B -2.1167
48 N B -1.4753
49 R B -0.8867
50 G B -0.4727
51 V B 0.9250
52 H B -0.2234
53 N B -0.6887
54 A B 0.0000
55 S B 0.2575
56 L B 1.2407
57 A B 0.2625
58 L B 0.0000
59 S B 0.1341
60 A B -0.0446
61 S B -0.7124
62 I B 0.0000
63 G B -1.8839
64 R B -2.3858
65 V B 0.0000
66 R B -2.7989
67 E B -3.1909
68 L B 0.0000
69 C B 0.0000
70 A B -1.8996
71 Q B -2.0939
72 A B 0.0000
73 R B -2.3011
74 G B -1.6054
75 A B -1.7145
76 A B -1.4390
77 S B -1.6243
78 K B -2.2326
79 V B 0.0000
80 K B -1.2777
81 V B 0.6643
1 D C -2.8201
2 A C -2.2895
3 R C -3.2812
4 R C -3.4369
5 K C -2.7300
6 A C 0.0000
7 E C -2.4823
8 M C -1.5775
9 L C 0.0000
10 Q C -2.1927
11 N C -2.4754
12 E C -1.9765
13 A C 0.0000
14 K C -2.3508
15 T C -1.5667
16 L C -1.0353
17 L C -1.3462
18 A C -0.9520
19 Q C -1.2529
20 A C 0.0000
21 N C -1.4132
22 S C -1.1823
23 K C -1.5457
24 L C -1.4020
25 Q C -1.6287
26 L C -1.2867
27 L C 0.0000
28 K C -2.3091
29 D C -2.4883
30 L C 0.0000
31 E C -2.8997
32 R C -4.1703
33 K C -4.0249
34 Y C 0.0000
35 E C -4.3720
36 D C -4.3227
37 N C -3.2954
38 Q C -3.0448
39 R C -3.5981
40 Y C -2.1434
41 L C 0.0000
42 E C -2.8933
43 D C -2.6029
44 K C -2.1179
45 A C -1.6921
46 Q C -2.2917
47 E C -2.3799
48 L C 0.0000
49 A C -1.8480
50 R C -2.7537
51 L C -1.9161
52 E C -2.2700
53 G C -2.2460
54 E C -2.6847
55 V C 0.0000
56 R C -2.8525
57 S C -2.2796
58 L C 0.0000
59 L C -2.5464
60 K C -3.1408
61 D C -2.8460
62 I C 0.0000
63 S C -2.1372
64 Q C -2.1109
65 K C -1.5840
66 V C 0.0000
67 A C -0.5510
68 V C -0.0537
69 Y C -0.6176
70 S C -0.8439
71 T C -0.5597
72 C C -0.8939
73 R C -2.0661
1 D D -1.3058
2 T D -0.2942
3 V D 0.6606
4 D D -0.6876
5 L D -0.7385
6 N D -1.9307
7 K D -1.8574
8 L D 0.0000
9 N D -3.0718
10 E D -3.3384
11 I D 0.0000
12 E D -2.4525
13 G D -2.3115
14 T D -2.1620
15 L D 0.0000
16 N D -2.3705
17 K D -3.2299
18 A D 0.0000
19 K D -2.4375
20 D D -3.0049
21 E D -2.1644
22 M D -1.8102
23 K D -2.2346
24 V D 0.0883
25 S D -1.0322
26 D D -1.8269
27 L D 0.0000
28 D D -3.6191
29 R D -3.8613
30 K D -3.4399
31 V D 0.0000
32 S D -3.1980
33 D D -4.2720
34 L D 0.0000
35 E D -3.6403
36 N D -4.1400
37 E D -4.2527
38 A D 0.0000
39 K D -4.3737
40 K D -3.9234
41 Q D -3.1488
42 E D -3.0759
43 A D -2.0078
44 A D -1.6982
45 I D 0.0000
46 M D -1.1280
47 D D -2.4671
48 Y D -1.8634
49 N D -2.0145
50 R D -3.3541
51 D D -3.0169
52 I D 0.0000
53 E D -3.2390
54 E D -3.3959
55 I D 0.0000
56 M D -2.1273
57 K D -2.9113
58 C D -2.4589
59 I D 0.0000
60 R D -3.4741
61 N D -3.0512
62 L D 0.0000
63 E D -3.4538
64 D D -3.5215
65 I D -2.3598
66 R D -2.6944
67 K D -2.7156
68 T D -1.2586
69 L D -0.8144
70 P D -0.3057
71 S D -0.5168
72 G D -0.4613
73 C D -0.8821
74 H D -1.6890
75 N D -2.1385
76 T D -0.9799
77 P D -0.7379
78 S D -0.3640
79 I D 0.3722
80 E D -1.8395
81 K D -2.1345
82 P D -1.2832
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.6702 1.638 View CSV PDB
4.5 -1.7869 1.6402 View CSV PDB
5.0 -1.932 1.6462 View CSV PDB
5.5 -2.0784 1.6581 View CSV PDB
6.0 -2.1971 1.6741 View CSV PDB
6.5 -2.2679 1.6877 View CSV PDB
7.0 -2.2883 1.6953 View CSV PDB
7.5 -2.2726 1.6984 View CSV PDB
8.0 -2.2361 1.6995 View CSV PDB
8.5 -2.1846 1.6998 View CSV PDB
9.0 -2.1162 1.6999 View CSV PDB