Project name: AlaAla_R1

Status: done

Started: 2026-08-20 07:35:24
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:27)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/67b57f824003c91/tmp/folded.pdb                (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:27)
Show buried residues

Minimal score value
-2.611
Maximal score value
2.6552
Average score
-0.5488
Total score value
-136.1044

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6976
2 V A 0.0000
3 Q A -2.0621
4 L A 0.0000
5 Q A -1.8591
6 E A 0.0000
7 S A -0.7037
8 G A -0.3805
9 P A 0.0374
10 G A 0.3732
11 L A 0.9668
12 V A 0.0000
13 K A -1.8389
14 P A -1.3782
15 S A -1.4943
16 Q A -2.0696
17 T A -1.8405
18 L A 0.0000
19 S A -1.1379
20 L A 0.0000
21 T A -0.6588
22 A A 0.0000
23 T A -1.2501
24 V A 0.0000
25 S A -1.3923
26 G A -1.4263
27 G A -1.0984
28 S A -0.6509
29 I A 0.0000
30 S A -0.2320
31 S A -0.2587
32 G A -0.2858
33 D A 0.0075
34 Y A 0.7799
35 Y A 0.7215
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.2351
41 Q A 0.0000
42 P A -0.6877
43 P A -0.6903
44 G A -1.1311
45 C A -1.2629
46 K A -2.0120
47 G A -1.2429
48 L A 0.0000
49 E A -0.7497
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.0947
54 I A 0.0000
55 Y A 0.2974
56 Y A 0.2912
57 S A -0.1133
58 G A -0.2321
59 S A -0.2801
60 T A -0.2803
61 D A -0.7306
62 Y A -0.7294
63 N A -0.9212
64 P A -1.2453
65 S A -1.1309
66 L A 0.0000
67 K A -2.1189
68 S A -1.4985
69 R A -1.8849
70 V A 0.0000
71 T A -1.2868
72 M A 0.0000
73 S A -0.4359
74 V A -0.3796
75 D A -1.2239
76 T A -1.0290
77 S A -1.3337
78 K A -2.1818
79 N A -1.4562
80 Q A -1.2810
81 F A 0.0000
82 S A -0.6073
83 L A 0.0000
84 K A -1.9510
85 V A 0.0000
86 N A -2.2135
87 S A -1.7221
88 V A 0.0000
89 T A -0.7259
90 A A -0.3119
91 A A -0.1864
92 D A 0.0000
93 T A 0.2354
94 A A 0.0000
95 V A 0.1446
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 1.1866
103 I A 2.0409
104 F A 2.5945
105 G A 1.9826
106 V A 2.6552
107 G A 0.0000
108 T A 0.0000
109 F A 0.0000
110 D A -0.6674
111 Y A -0.6777
112 W A -0.8895
113 G A 0.0000
114 Q A -1.6726
115 G A -0.8063
116 T A -0.2227
117 L A 0.8027
118 V A 0.0000
119 T A 0.3417
120 V A 0.0000
121 S A -0.3952
122 S A -0.6938
123 A A -0.5954
124 A A -0.3622
125 G A -0.8387
126 G A -1.0785
127 G A -1.1451
128 G A -1.1763
129 S A -1.0189
130 G A -1.1810
131 G A -1.1970
132 G A -1.1913
133 G A -1.2208
134 S A -1.1740
135 G A -1.2256
136 G A -1.3831
137 G A -1.2377
138 G A -1.1887
139 S A -0.9509
140 D A -0.8929
141 I A -0.0949
142 V A 1.0254
143 M A 0.0000
144 T A -0.5922
145 Q A -0.8446
146 S A -0.6837
147 P A -0.2931
148 A A -0.2750
149 T A -0.3812
150 L A -0.1944
151 S A -0.6421
152 L A -1.0338
153 S A -1.6021
154 P A -1.8861
155 G A -1.7581
156 E A -2.4106
157 R A -2.6110
158 A A 0.0000
159 T A -0.6664
160 L A 0.0000
161 S A -0.8793
162 A A 0.0000
163 R A -2.3358
164 A A 0.0000
165 S A -0.8496
166 Q A -1.5667
167 S A -1.1985
168 V A 0.0000
169 S A -0.4091
170 S A -0.1168
171 Y A 1.0709
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3787
179 P A -0.8079
180 G A -0.9966
181 C A -1.1781
182 Q A -1.6711
183 A A -1.2431
184 P A 0.0000
185 R A -1.5632
186 L A -0.6668
187 L A 0.0000
188 I A 0.0000
189 Y A -0.0580
190 D A -0.1326
191 A A 0.0000
192 S A -0.8209
193 N A -1.1722
194 R A -1.2530
195 A A -0.8607
196 T A -0.6300
197 G A -0.6417
198 I A 0.0000
199 P A -0.4208
200 A A -0.3650
201 R A -0.7128
202 F A 0.0000
203 S A -0.6227
204 G A -0.6361
205 S A -0.7995
206 G A -1.1211
207 S A -0.9208
208 G A -1.0379
209 T A -1.7602
210 D A -2.1792
211 F A 0.0000
212 T A -0.7763
213 L A 0.0000
214 T A -0.5924
215 I A 0.0000
216 S A -1.3773
217 S A -1.7330
218 L A 0.0000
219 E A -1.8582
220 P A -1.7437
221 E A -2.0869
222 D A 0.0000
223 F A -0.7401
224 A A 0.0000
225 V A -0.3964
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A 0.3565
233 S A 0.0124
234 T A -0.3927
235 P A -0.4646
236 L A 0.0000
237 T A 0.1788
238 F A 0.2552
239 G A 0.0000
240 G A -0.7761
241 G A -0.7058
242 T A 0.0000
243 K A -0.6473
244 A A 0.0000
245 E A -1.0609
246 I A -1.3883
247 K A -1.7096
248 A A -0.8298
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5202 5.0586 View CSV PDB
4.5 -0.5416 5.0561 View CSV PDB
5.0 -0.5658 5.0493 View CSV PDB
5.5 -0.5869 5.035 View CSV PDB
6.0 -0.5985 5.0126 View CSV PDB
6.5 -0.5967 4.9849 View CSV PDB
7.0 -0.5825 4.9551 View CSV PDB
7.5 -0.5602 4.9244 View CSV PDB
8.0 -0.5334 4.8936 View CSV PDB
8.5 -0.5032 4.8627 View CSV PDB
9.0 -0.4702 4.832 View CSV PDB