Project name: 682257a1291ca01

Status: done

Started: 2026-04-17 01:47:16
Chain sequence(s) A: GQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGGTGNQFYFGTGTSLTVIPGGGSEGGGSEGGGSEGGGSEGGTGDAGITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISEVGVGQPQHFGDGTRLSIL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:43)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/682257a1291ca01/tmp/folded.pdb                (00:02:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:28)
Show buried residues

Minimal score value
-2.973
Maximal score value
2.0886
Average score
-0.6606
Total score value
-162.5165

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 G A -1.1322
2 Q A -1.2774
3 Q A -1.8496
4 L A 0.0000
5 N A -2.0041
6 Q A 0.0000
7 S A -1.0668
8 P A -1.0813
9 Q A -1.5064
10 S A -0.3137
11 M A 0.7935
12 F A 2.0886
13 I A 0.2519
14 Q A -1.2674
15 E A -1.4248
16 G A -1.7872
17 E A -2.5342
18 D A -2.8325
19 V A 0.0000
20 S A -0.8512
21 M A 0.0000
22 N A -1.0228
23 C A 0.0000
24 T A -1.2291
25 S A 0.0000
26 S A -0.7828
27 S A -0.3195
28 I A 0.3156
29 F A 0.0000
30 N A -0.5196
31 T A 0.0000
32 W A 0.0000
33 L A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A 0.4974
37 Q A 0.0000
38 E A -1.0846
39 P A -1.0516
40 G A -1.4867
41 E A -1.2758
42 G A 0.0000
43 P A 0.0000
44 V A 1.5003
45 L A 1.2461
46 L A 0.6201
47 I A 0.0000
48 A A 0.0653
49 L A 0.0000
50 Y A -0.1903
51 K A -1.2040
52 A A -0.3318
53 G A 0.3523
54 E A 0.0904
55 L A 1.0679
56 T A 0.1996
57 S A -0.7697
58 N A -1.6806
59 G A -1.4130
60 R A -1.3942
61 L A -0.9639
62 T A -0.3956
63 A A 0.0000
64 Q A 0.3339
65 F A 0.0000
66 G A 0.0000
67 I A 1.1436
68 T A 0.4469
69 R A -0.4557
70 K A -0.6760
71 D A -0.9284
72 S A 0.0000
73 F A 0.0203
74 L A 0.0000
75 N A -1.0274
76 I A 0.0000
77 S A -1.4476
78 A A -1.5284
79 S A 0.0000
80 I A 0.0643
81 P A 0.2181
82 S A 0.1286
83 D A 0.0000
84 V A 0.9973
85 G A 0.0000
86 I A 0.0629
87 Y A 0.0000
88 F A 0.0000
89 C A 0.0000
90 A A 0.0000
91 G A 0.0000
92 G A 0.0000
93 T A 0.0449
94 G A 0.1263
95 N A 0.3616
96 Q A -0.2779
97 F A 0.0000
98 Y A -0.6470
99 F A 0.0000
100 G A 0.0000
101 T A -1.1703
102 G A 0.0000
103 T A 0.0000
104 S A 0.0415
105 L A 0.0000
106 T A 1.1505
107 V A 0.0000
108 I A 0.8768
109 P A -0.3953
110 G A -1.0515
111 G A -1.2232
112 G A -1.4158
113 S A -1.6492
114 E A -2.5021
115 G A -1.7974
116 G A -1.4856
117 G A -1.5134
118 S A -1.5451
119 E A -2.3955
120 G A -1.7566
121 G A -1.5366
122 G A -1.5935
123 S A -1.6962
124 E A -2.5028
125 G A -1.8522
126 G A -1.7580
127 G A -1.7825
128 S A -1.7607
129 E A -2.5111
130 G A -1.8136
131 G A -1.8124
132 T A -1.6162
133 G A -1.3460
134 D A -2.2941
135 A A -1.3393
136 G A -1.5925
137 I A 0.0000
138 T A -0.9418
139 Q A 0.0000
140 S A -1.3716
141 P A -1.6449
142 R A -2.3401
143 H A -2.1145
144 K A -1.0588
145 V A 0.8353
146 T A 0.0000
147 E A -1.1483
148 T A -0.9400
149 G A -1.3124
150 T A -1.3698
151 P A -1.4296
152 V A 0.0000
153 T A -0.6152
154 L A 0.0000
155 R A -1.2227
156 C A 0.0000
157 H A -1.3028
158 Q A 0.0000
159 T A -1.7654
160 E A -2.9684
161 N A -2.9730
162 H A -2.2181
163 R A -2.0286
164 Y A -0.8568
165 M A 0.0000
166 Y A 0.0000
167 W A 0.0000
168 Y A 0.0000
169 R A -0.9812
170 Q A -1.2052
171 D A -1.0978
172 P A -0.9212
173 G A -1.2997
174 H A -1.5879
175 G A 0.0000
176 L A 0.0000
177 R A -1.6798
178 L A 0.0000
179 I A 0.0000
180 H A 0.0000
181 Y A 0.0000
182 S A 0.0000
183 Y A -0.6279
184 G A -1.3320
185 V A -1.2245
186 K A -2.3957
187 D A -2.3083
188 T A -1.7475
189 D A -2.0428
190 K A -2.4844
191 G A -1.9304
192 E A -1.8940
193 V A -1.4839
194 S A -1.9052
195 D A -2.3414
196 G A -1.7342
197 Y A 0.0000
198 S A -0.8533
199 V A -0.3344
200 S A -0.7636
201 R A 0.0000
202 S A -1.4033
203 K A -1.9349
204 T A -1.9623
205 E A -1.9696
206 D A -1.2627
207 F A 0.0000
208 L A -0.0801
209 L A 0.0000
210 T A -0.6984
211 L A 0.0000
212 E A -2.2332
213 S A -1.7143
214 A A 0.0000
215 T A -0.7587
216 S A -0.3019
217 S A -0.3818
218 Q A 0.0000
219 T A -0.2152
220 S A 0.0000
221 V A -1.1157
222 Y A 0.0000
223 F A 0.0000
224 C A 0.0000
225 A A 0.0000
226 I A 0.0000
227 S A 0.0000
228 E A -0.9503
229 V A 1.0437
230 G A 0.9521
231 V A 1.5571
232 G A 0.0000
233 Q A 0.2300
234 P A -0.2175
235 Q A 0.0000
236 H A -0.3555
237 F A 0.0000
238 G A 0.0000
239 D A -1.5603
240 G A 0.0000
241 T A 0.0000
242 R A -2.5091
243 L A 0.0000
244 S A -0.1290
245 I A 0.0000
246 L A 1.0532
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4627 4.3856 View CSV PDB
4.5 -0.5157 4.3737 View CSV PDB
5.0 -0.5809 4.3572 View CSV PDB
5.5 -0.6473 4.3388 View CSV PDB
6.0 -0.7036 4.3214 View CSV PDB
6.5 -0.7403 4.3079 View CSV PDB
7.0 -0.7561 4.3 View CSV PDB
7.5 -0.7584 4.2966 View CSV PDB
8.0 -0.7539 4.2953 View CSV PDB
8.5 -0.7439 4.2949 View CSV PDB
9.0 -0.7277 4.2948 View CSV PDB