Project name: 683b2e33b605c0e

Status: done

Started: 2026-03-11 19:23:03
Chain sequence(s) A: MDDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSIGGSSGGFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:43)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/683b2e33b605c0e/tmp/folded.pdb                (00:02:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:48)
Show buried residues

Minimal score value
-5.4301
Maximal score value
3.6467
Average score
-0.8696
Total score value
-280.0015

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.2086
2 D A -1.3521
3 D A -2.7088
4 R A -2.4812
5 F A -0.4401
6 N A -2.0977
7 D A -1.8334
8 V A 0.5848
9 N A -0.6391
10 T A -0.4910
11 I A 0.4416
12 N A -2.0551
13 K A -2.7650
14 K A -2.6872
15 Q A -1.8531
16 F A 0.2527
17 T A -0.9880
18 E A -2.0165
19 E A -2.2453
20 E A -0.8307
21 F A 0.7833
22 S A -0.6789
23 R A -1.5264
24 L A 0.5229
25 I A 0.4133
26 N A -0.7885
27 S A -0.4398
28 M A 0.0254
29 L A 0.0307
30 K A -1.9116
31 E A -2.5874
32 Y A -0.7213
33 I A -1.0906
34 E A -4.0676
35 D A -4.7336
36 N A -4.7035
37 K A -5.2710
38 K A -5.4301
39 D A -5.4249
40 K A -4.8064
41 H A -3.4224
42 P A -2.4209
43 T A -1.8151
44 Q A -2.3023
45 K A -2.4379
46 T A -1.6067
47 T A -1.3669
48 P A -1.4610
49 K A -2.0069
50 P A -1.2553
51 T A -1.0528
52 T A -1.1091
53 P A -1.2438
54 K A -2.0326
55 Q A -1.7427
56 I A -0.2876
57 N A -1.8903
58 D A -2.3329
59 G A -1.7351
60 T A -1.7357
61 S A -2.0229
62 D A -2.8672
63 K A -2.9630
64 T A -2.0576
65 S A -2.0407
66 D A -2.4787
67 T A -1.2822
68 H A -1.3297
69 T A -0.6564
70 I A 0.3322
71 K A -1.8141
72 R A -2.2349
73 T A -1.4956
74 T A -1.4708
75 P A -1.4943
76 K A -2.0071
77 P A -1.2526
78 T A -1.0481
79 T A -1.1336
80 P A -1.2313
81 K A -1.9845
82 Q A -1.7106
83 I A -0.3189
84 N A -1.8534
85 D A -2.3175
86 G A -1.7265
87 T A -1.7729
88 S A -1.9894
89 D A -2.8705
90 K A -2.9590
91 T A -2.0575
92 S A -2.0579
93 D A -2.4699
94 T A -1.2798
95 H A -1.3040
96 T A -0.6567
97 I A 0.3245
98 K A -1.8085
99 R A -2.2253
100 T A -1.5269
101 T A -1.4480
102 P A -1.4732
103 K A -2.0051
104 P A -1.2582
105 T A -1.0259
106 T A -1.1310
107 P A -1.1970
108 K A -2.0553
109 Q A -1.7287
110 I A -0.2621
111 N A -1.8879
112 D A -2.3298
113 G A -1.7708
114 T A -1.7085
115 S A -2.0225
116 D A -3.1635
117 K A -3.2410
118 P A -2.3508
119 K A -2.3014
120 S A -0.1110
121 I A 2.0639
122 A A 1.6904
123 D A 0.8230
124 I A 2.5481
125 F A 3.4260
126 L A 2.9183
127 I A 2.2868
128 N A -0.6927
129 K A -1.6353
130 P A -1.4009
131 K A -2.0591
132 V A 0.4278
133 P A 0.9169
134 L A 1.8879
135 W A 3.2988
136 I A 3.6467
137 V A 3.2346
138 N A 1.9849
139 P A 2.4607
140 L A 2.9388
141 Y A 2.8208
142 Y A 2.9604
143 M A 2.9262
144 V A 3.4419
145 E A 1.6848
146 K A 1.4630
147 F A 3.3817
148 V A 3.0378
149 Q A 1.5289
150 I A 2.7089
151 M A 2.3838
152 G A 1.5657
153 Y A 2.0288
154 L A 1.8148
155 L A 0.8272
156 E A -1.6236
157 D A -2.3444
158 D A -3.1933
159 D A -2.9698
160 T A -1.3082
161 L A -0.3209
162 E A -0.9950
163 L A 0.8012
164 N A -0.5718
165 L A 1.0393
166 P A 0.3455
167 K A -0.3075
168 Y A 1.3946
169 Y A 2.0519
170 Y A 1.4441
171 D A -0.1973
172 K A -1.0949
173 S A -0.2515
174 I A 1.1363
175 G A -0.3856
176 G A -0.6727
177 S A -0.7749
178 S A -1.0150
179 G A -1.0837
180 G A -1.1203
181 F A -1.1899
182 D A -2.5597
183 A A -1.9130
184 S A -2.1603
185 N A -2.4408
186 F A 0.0000
187 K A -2.3483
188 D A -1.1888
189 F A -0.3775
190 S A -0.6025
191 S A -1.0888
192 I A 0.0000
193 A A -0.3055
194 S A -0.4429
195 A A -0.6088
196 S A -0.5153
197 S A 0.0000
198 S A -0.0050
199 W A 0.0000
200 Q A -0.8715
201 N A 0.0000
202 Q A -1.7980
203 S A -1.4428
204 G A -1.3104
205 S A 0.0000
206 T A -0.7464
207 M A 0.0000
208 I A 0.0254
209 I A 0.0000
210 Q A -1.2157
211 V A 0.0000
212 D A -0.4518
213 S A 0.3500
214 F A 1.1992
215 G A 0.0000
216 N A -0.8918
217 V A 0.0000
218 S A -1.0086
219 G A -0.7215
220 Q A -0.7989
221 Y A 0.0000
222 V A 0.0000
223 N A 0.0000
224 R A -2.6572
225 A A -1.9702
226 Q A -1.9760
227 G A -1.4130
228 T A -1.1645
229 G A -1.4972
230 C A 0.0000
231 Q A -2.3545
232 N A -2.1280
233 S A -1.5024
234 P A -1.0513
235 Y A 0.0000
236 P A -0.9045
237 L A 0.0000
238 T A -0.9113
239 G A -1.1707
240 R A -1.8230
241 V A 0.0000
242 N A -0.9157
243 G A -0.4885
244 T A 0.1534
245 F A 1.2862
246 I A 0.0000
247 A A -0.3484
248 F A 0.0000
249 S A -0.6079
250 V A 0.0000
251 G A -1.1049
252 W A 0.0000
253 N A -2.6382
254 N A -1.7901
255 S A -1.2086
256 T A -1.4911
257 E A -2.4412
258 N A -2.7088
259 C A -1.8318
260 N A -2.2225
261 S A -1.0162
262 A A -0.4557
263 T A 0.0000
264 G A -0.5505
265 W A 0.0000
266 T A -0.0455
267 G A 0.0000
268 Y A 1.1496
269 A A 0.0000
270 Q A -0.5603
271 V A -1.2241
272 N A -1.7773
273 G A -1.6832
274 N A -2.2462
275 N A -1.6614
276 T A 0.0000
277 E A -0.5656
278 I A 0.0000
279 V A 0.2900
280 T A 0.0000
281 S A -0.9638
282 W A -0.9923
283 N A -0.9999
284 L A -0.2519
285 A A -0.0393
286 Y A -0.5123
287 E A -1.8459
288 G A -1.1377
289 G A -1.0645
290 S A -0.9046
291 G A -1.0478
292 P A -0.7920
293 A A -0.0482
294 I A 0.9379
295 E A -0.7191
296 Q A -1.7415
297 G A -1.7121
298 Q A -1.8013
299 D A -1.1529
300 T A -0.7333
301 F A 0.0000
302 Q A -0.7086
303 Y A 0.1213
304 V A 0.4946
305 P A -0.4116
306 T A -0.7249
307 T A -1.5783
308 E A -3.0426
309 N A -2.8265
310 K A -2.4922
311 S A -0.8800
312 L A 0.8049
313 L A 0.7035
314 K A -1.7463
315 D A -2.5716
316 T A -2.0651
317 H A -2.7185
318 H A -2.6798
319 H A -2.6483
320 H A -2.6751
321 H A -2.3759
322 H A -1.8765
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3871 7.0902 View CSV PDB
4.5 -0.4782 7.0902 View CSV PDB
5.0 -0.5794 7.0902 View CSV PDB
5.5 -0.6675 7.0902 View CSV PDB
6.0 -0.7192 7.0902 View CSV PDB
6.5 -0.7255 7.0902 View CSV PDB
7.0 -0.6972 7.0902 View CSV PDB
7.5 -0.6501 7.0902 View CSV PDB
8.0 -0.5915 7.0901 View CSV PDB
8.5 -0.5197 7.09 View CSV PDB
9.0 -0.4323 7.0894 View CSV PDB