Project name: HS_219

Status: done

Started: 2026-03-20 01:19:39
Chain sequence(s) A: QVQLQQSGPELVRPAASVKMSCKASGYTFTNYWMHWVKQRPGQGLEWIGMIDPSNSEITLNQKFKDKATLNVDKSSNTAYIQLSSLTSEDSAVYYCSRGVSWGQGTLVTVSA
B: DIQMTQSPSSLSASLGERVSLTCRASQDIGSRLTWLQQDPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYDSSPWTFGGGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:13)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:44:40)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:44:42)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:44:43)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:44:44)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:44:45)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:44:46)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:44:47)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:44:48)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:44:49)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:44:50)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:44:51)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:44:52)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:44:53)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:44:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:44:59)
Show buried residues

Minimal score value
-2.8946
Maximal score value
2.0484
Average score
-0.5633
Total score value
-123.9363

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.8338
2 V A 0.0000
3 Q A -2.0176
4 L A 0.0000
5 Q A -2.1455
6 Q A 0.0000
7 S A -0.9866
8 G A -0.5443
9 P A -0.2446
10 E A 0.0018
11 L A 0.9341
12 V A 0.0000
13 R A -1.5944
14 P A -0.9461
15 A A -0.4528
16 A A -0.5154
17 S A -0.7669
18 V A 0.0000
19 K A -1.8017
20 M A 0.0000
21 S A 0.0000
22 C A 0.0000
23 K A -2.1115
24 A A 0.0000
25 S A -1.0275
26 G A -0.5240
27 Y A 0.6184
28 T A -0.1295
29 F A -0.2776
30 T A -0.4429
31 N A -0.9632
32 Y A 0.1029
33 W A 0.4068
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A 0.0000
39 Q A 0.0000
40 R A -1.1225
41 P A -1.0688
42 G A -1.2454
43 Q A -1.0951
44 G A -0.7672
45 L A 0.0000
46 E A -0.7588
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 M A 0.0000
51 I A 1.1236
52 D A 0.0000
53 P A -0.2223
54 S A -0.8654
55 N A -0.7211
56 S A -0.2253
57 E A 0.6096
58 I A 2.0484
59 T A 1.4684
60 L A 0.9484
61 N A -0.6421
62 Q A -1.8030
63 K A -1.7708
64 F A 0.0000
65 K A -2.6788
66 D A -2.3050
67 K A -2.5673
68 A A -1.4853
69 T A -0.6736
70 L A -0.2632
71 N A -0.9870
72 V A -0.4268
73 D A -1.8717
74 K A -2.3206
75 S A -1.3749
76 S A -1.3803
77 N A -1.3556
78 T A 0.0000
79 A A 0.0000
80 Y A -0.7565
81 I A 0.0000
82 Q A -2.1367
83 L A 0.0000
84 S A -1.3649
85 S A -1.1482
86 L A 0.0000
87 T A -0.8996
88 S A -1.1003
89 E A -2.0735
90 D A 0.0000
91 S A -0.5021
92 A A 0.0000
93 V A 0.1265
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 S A 0.0000
98 R A 0.0000
99 G A 0.0457
100 V A 0.0000
101 S A 0.0000
102 W A -0.3684
103 G A 0.0000
104 Q A -1.0203
105 G A -0.7909
106 T A 0.0000
107 L A 0.4558
108 V A 0.0000
109 T A 0.1472
110 V A -0.3127
111 S A -0.4931
112 A A -0.5091
1 D B -2.1482
2 I B -0.9630
3 Q B -1.6156
4 M B 0.0000
5 T B -1.1046
6 Q B -1.0446
7 S B -0.8101
8 P B -0.5025
9 S B -0.7421
10 S B -1.0959
11 L B -1.0276
12 S B -1.3626
13 A B 0.0000
14 S B -0.9877
15 L B 0.0958
16 G B -1.0216
17 E B -2.5300
18 R B -2.5364
19 V B -1.2598
20 S B -0.4524
21 L B 0.0000
22 T B -0.9198
23 C B 0.0000
24 R B -2.5759
25 A B 0.0000
26 S B -1.2386
27 Q B -0.8405
28 D B -0.2335
29 I B 1.2476
30 G B 0.1220
31 S B -0.4018
32 R B -0.6747
33 L B 0.0000
34 T B 0.0000
35 W B 0.0000
36 L B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 D B -1.6689
40 P B -1.7407
41 D B -2.1797
42 G B 0.0000
43 T B 0.0000
44 I B 0.0000
45 K B -0.5988
46 R B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.3105
50 A B 0.0000
51 T B -0.0183
52 S B 0.0515
53 S B 0.3451
54 L B 1.0305
55 D B -0.4498
56 S B -0.8561
57 G B -1.1897
58 V B 0.0000
59 P B -1.2641
60 K B -2.0544
61 R B -0.6622
62 F B 0.1783
63 S B 0.4004
64 G B 0.0462
65 S B -0.7063
66 R B -1.3570
67 S B -1.0029
68 G B -1.1052
69 S B -1.4995
70 D B -2.1381
71 Y B 0.0000
72 S B -1.0010
73 L B 0.0000
74 T B -0.3242
75 I B 0.0000
76 S B -0.9411
77 S B 0.0000
78 L B -0.4101
79 E B -1.7237
80 S B -1.5210
81 E B -1.5254
82 D B -1.5917
83 F B 0.0000
84 V B 0.0000
85 D B 0.0000
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 L B 0.0000
90 Q B 0.0000
91 Y B -0.2783
92 D B -0.6464
93 S B -0.0644
94 S B 0.0000
95 P B 0.0000
96 W B 0.0000
97 T B 0.0000
98 F B -0.0322
99 G B -0.4922
100 G B 0.0000
101 G B -0.8704
102 T B 0.0000
103 K B -1.6945
104 L B 0.0000
105 E B -2.7169
106 I B -1.9987
107 K B -2.6937
108 R B -2.8946
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5633 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_3 -0.5633 View CSV PDB
model_9 -0.6009 View CSV PDB
model_6 -0.6022 View CSV PDB
model_8 -0.6167 View CSV PDB
model_1 -0.6177 View CSV PDB
model_5 -0.6305 View CSV PDB
model_2 -0.6402 View CSV PDB
model_4 -0.6568 View CSV PDB
CABS_average -0.6605 View CSV PDB
model_0 -0.6805 View CSV PDB
model_7 -0.7238 View CSV PDB
model_10 -0.7591 View CSV PDB
input -0.8311 View CSV PDB
model_11 -0.8346 View CSV PDB