Project name: 6a19ef701cc2e80

Status: done

Started: 2026-06-26 08:26:16
Chain sequence(s) A: RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
B: MKMRKLGDSFFKPP
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6a19ef701cc2e80/tmp/folded.pdb                (00:04:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:00)
Show buried residues

Minimal score value
-4.0784
Maximal score value
1.2542
Average score
-0.7604
Total score value
-176.4092

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
217 R A -0.4544
218 S A 0.0000
219 V A 0.0000
220 A A -0.2211
221 S A -0.7080
222 S A -0.9104
223 K A -1.7380
224 L A 0.0000
225 W A 0.0154
226 M A 0.0000
227 L A -0.3964
228 E A -1.0908
229 F A 0.0000
230 S A 0.0000
231 A A -0.0212
232 F A 0.0000
233 L A 0.0000
234 E A -0.8647
235 Q A 0.0000
236 Q A -2.0419
237 Q A -2.5161
238 D A -2.5473
239 P A -1.8795
240 D A -2.3105
241 T A -1.4108
242 Y A -0.5701
243 N A -1.3599
244 K A -1.8755
245 H A -1.5065
246 L A -0.5502
247 F A 0.0000
248 V A 0.0000
249 H A -0.5925
250 I A 0.0000
251 G A -1.0592
252 Q A -1.5612
253 S A -1.0124
254 S A -0.8062
255 P A -0.6353
256 S A -0.2318
257 Y A 0.5738
258 S A 0.3022
259 D A 0.1607
260 P A -0.0276
261 Y A 0.6588
262 L A 0.0000
263 E A -1.4351
264 A A -0.9693
265 V A -1.0469
266 D A -1.9792
267 I A 0.0000
268 R A -3.1797
269 Q A -2.7026
270 I A 0.0000
271 Y A -2.2094
272 D A -2.3496
273 K A -1.1757
274 F A 0.0000
275 P A -2.5491
276 E A -4.0784
277 K A -3.8018
278 K A -3.3383
279 G A -2.0970
280 G A 0.0000
281 L A 0.0000
282 K A -3.7424
283 D A -3.2448
284 L A -2.1890
285 F A 0.0000
286 E A -3.3449
287 R A -3.0798
288 G A 0.0000
289 P A -1.4195
290 S A -1.2962
291 N A -1.1151
292 A A 0.0000
293 F A 0.0000
294 F A 0.0000
295 L A 0.0000
296 V A 0.0000
297 K A 0.0000
298 F A 0.0000
299 W A 0.0000
300 A A 0.0000
301 D A 0.0000
302 L A 0.0000
303 N A -1.6747
304 T A 0.0000
305 N A -2.2308
306 I A -0.8785
307 E A 0.0000
308 D A -2.8957
309 E A -2.8825
310 G A -1.7652
311 S A -1.4007
312 S A -0.8131
313 F A 0.1273
314 Y A 0.0000
315 G A 0.0000
316 V A -0.2587
317 S A -1.1216
318 S A 0.0000
319 Q A -1.2911
320 Y A 0.0000
321 E A -1.1378
322 S A 0.0000
323 P A -1.5262
324 E A -2.5786
325 N A -1.9477
326 M A 0.0000
327 I A -0.1485
328 I A 0.0000
329 T A -0.3033
330 C A 0.0000
331 S A 0.3450
332 T A 0.1081
333 K A -0.3708
334 V A 0.0000
335 C A 0.0000
336 S A 0.3335
337 F A 0.8620
338 G A 0.0000
339 K A -1.7832
340 Q A -1.1362
341 V A 0.4319
342 V A -0.0661
343 E A -0.1372
344 K A 0.2504
345 V A 1.2542
346 E A 0.2428
347 T A -0.1752
348 E A -0.8554
349 Y A 0.2874
350 A A 0.0000
351 R A -1.6086
352 Y A -0.5342
353 E A -1.3181
354 N A -1.5694
355 G A -1.0637
356 H A -1.3667
357 Y A -1.1165
358 S A 0.0000
359 Y A 0.0000
360 R A -2.6483
361 I A 0.0000
362 H A -1.9620
363 R A -1.4651
364 S A -0.9926
365 P A -0.5879
366 L A -0.2055
367 C A -0.6464
368 E A -1.5200
369 Y A -0.2506
370 M A 0.0000
371 I A -0.6431
372 N A -1.3640
373 F A -0.7846
374 I A 0.0000
375 H A -1.4635
376 K A -2.1205
377 L A 0.0000
378 K A -1.6382
379 H A -1.7864
380 L A -0.7603
381 P A -0.6450
382 E A -0.8174
383 K A -0.3582
384 Y A 0.9106
385 M A 0.4767
386 M A -0.0911
387 N A 0.0086
388 S A 0.2508
389 V A 0.6491
390 L A 0.0000
391 E A -0.4989
392 N A -0.0733
393 F A 0.0000
394 T A 0.0000
395 I A 0.0526
396 L A 0.0000
397 Q A 0.0000
398 V A 0.0000
399 V A 0.0000
400 T A 0.0000
401 N A -1.7544
402 R A -2.2003
403 D A -2.6144
404 T A -1.9545
405 Q A -2.4164
406 E A -2.1221
407 T A 0.0000
408 L A 0.0000
409 L A 0.0000
410 C A 0.0000
411 I A 0.0000
412 A A 0.0000
413 Y A 0.0000
414 V A 0.0000
415 F A 0.0000
416 E A 0.0000
417 V A 0.0000
418 S A 0.0000
419 A A -0.7998
420 S A -1.3119
421 E A -2.3350
422 H A -1.9518
423 G A -1.3627
424 A A 0.0000
425 Q A -0.5338
426 H A -0.4067
427 H A -0.4233
428 I A 0.0000
429 Y A 0.0000
430 R A -0.7920
431 L A 0.0000
432 V A -1.0078
433 K A -2.4761
434 E A -2.6461
1 M B -0.0865
2 K B -1.1300
3 M B -0.9275
4 R B -1.2125
5 K B -1.4731
6 L B -0.1385
7 G B 0.0000
8 D B -1.2506
9 S B -0.8932
10 F B -0.2011
11 F B -0.3604
12 K B -1.6026
13 P B -1.0367
14 P B -0.7671
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6997 2.8579 View CSV PDB
4.5 -0.7646 2.7814 View CSV PDB
5.0 -0.8433 2.6871 View CSV PDB
5.5 -0.9178 2.5965 View CSV PDB
6.0 -0.9697 2.5353 View CSV PDB
6.5 -0.9877 2.5273 View CSV PDB
7.0 -0.9751 2.5716 View CSV PDB
7.5 -0.9438 2.647 View CSV PDB
8.0 -0.9031 2.7367 View CSV PDB
8.5 -0.856 2.8355 View CSV PDB
9.0 -0.803 2.9471 View CSV PDB