Project name: 6a35a4c7ff03208

Status: done

Started: 2026-08-14 09:22:45
Chain sequence(s) A: ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:03)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6a35a4c7ff03208/tmp/folded.pdb                (00:06:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:31)
Show buried residues

Minimal score value
-2.8546
Maximal score value
2.2168
Average score
-0.7163
Total score value
-205.5834

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
26 A A -0.6840
27 D A -0.9838
28 L A 0.7054
29 G A 0.3489
30 Y A 0.9534
31 G A 0.0894
32 P A -0.2615
33 A A -0.0928
34 T A -0.2685
35 P A -0.2980
36 A A -0.0996
37 A A -0.0914
38 P A -0.2564
39 A A 0.0335
40 A A 0.0829
41 G A 0.1438
42 Y A 1.0143
43 T A 0.3371
44 P A -0.0180
45 A A 0.0095
46 T A -0.2190
47 P A -0.2904
48 A A -0.1076
49 A A -0.3189
50 P A -0.6129
51 A A -0.9252
52 E A -1.8273
53 A A -0.8712
54 A A -0.5542
55 P A -0.7101
56 A A -0.6612
57 G A -1.2958
58 K A -1.9278
59 A A -1.0958
60 T A -1.4194
61 T A -1.4498
62 E A -2.2021
63 E A -1.6713
64 Q A -2.0690
65 K A -2.6998
66 L A 0.0000
67 I A 0.0000
68 E A -2.8546
69 K A -2.6571
70 I A 0.0000
71 N A -1.8938
72 A A -1.3777
73 G A 0.0000
74 F A 0.0000
75 K A -1.6657
76 A A -0.6567
77 A A 0.0000
78 L A -0.1708
79 A A -0.2155
80 A A -0.1301
81 A A 0.0000
82 A A -0.1924
83 G A -0.4499
84 V A -0.5690
85 Q A -1.2494
86 P A -1.3644
87 A A -1.2281
88 D A -1.2674
89 K A -1.4641
90 Y A -1.3219
91 R A -1.7221
92 T A -0.8589
93 F A 0.0000
94 V A 0.1088
95 A A -0.2686
96 T A -0.0994
97 F A 0.0000
98 G A -0.5950
99 A A -0.8509
100 A A -1.0655
101 S A 0.0000
102 N A -2.2780
103 K A -2.8222
104 A A 0.0000
105 F A -1.1415
106 A A -1.4616
107 E A -2.4161
108 G A -1.5964
109 L A -0.3799
110 S A -0.9314
111 G A -1.8215
112 E A -2.4440
113 P A -2.0057
114 K A -2.4548
115 G A -1.4499
116 A A -0.5719
117 A A -0.5098
118 E A -1.3563
119 S A -0.8159
120 S A -0.3481
121 S A -0.4807
122 K A 0.0000
123 A A -0.1343
124 A A -0.4544
125 L A 0.0000
126 T A -0.5282
127 S A -0.8898
128 K A -1.1908
129 L A 0.0000
130 D A -1.6608
131 A A -0.9675
132 A A 0.0000
133 Y A -0.7594
134 K A -1.5961
135 L A -0.5292
136 A A 0.0000
137 Y A -0.6044
138 K A -2.1904
139 T A -1.3055
140 A A 0.0000
141 E A -2.4617
142 G A -1.7510
143 A A -1.6676
144 T A -1.2639
145 P A -1.5795
146 E A -2.3730
147 A A -1.9018
148 K A -2.1953
149 Y A -1.4195
150 D A -2.0294
151 A A -1.4033
152 Y A 0.0000
153 V A -0.1969
154 A A -0.4837
155 T A -0.3280
156 L A 0.0000
157 S A -0.6230
158 E A -0.8327
159 A A 0.0000
160 L A 0.0000
161 R A -1.8674
162 I A -0.6997
163 I A 0.0000
164 A A -1.2575
165 G A -1.0027
166 T A 0.0000
167 L A -0.7349
168 E A -1.1960
169 V A 0.1547
170 H A -0.8119
171 A A -0.6309
172 V A 0.5586
173 K A -0.9662
174 P A -0.9640
175 A A -0.9051
176 A A -1.3329
177 E A -2.4219
178 E A -2.0444
179 V A 0.3938
180 K A -0.3216
181 V A 1.9475
182 I A 2.2168
183 P A 0.7062
184 A A 0.0414
185 G A -0.5059
186 E A -0.5004
187 L A -1.0444
188 Q A -1.8354
189 V A 0.0000
190 I A -1.2742
191 E A -2.4197
192 K A -1.8550
193 V A 0.0000
194 D A -1.3761
195 A A -0.8994
196 A A 0.0000
197 F A 0.0000
198 K A -1.1174
199 V A 0.5794
200 A A 0.0000
201 A A -0.5471
202 T A -0.3203
203 A A -0.1447
204 A A 0.0000
205 N A -1.2169
206 A A -0.7040
207 A A -0.8989
208 P A -1.1090
209 A A -1.5201
210 N A -1.7751
211 D A -1.6743
212 K A -1.1654
213 F A -0.3727
214 T A -0.3522
215 V A -0.2744
216 F A 0.0000
217 E A -0.5367
218 A A -0.5485
219 A A -0.5096
220 F A 0.0000
221 N A -1.9207
222 D A -2.3329
223 A A -1.3790
224 I A 0.0000
225 K A -2.1688
226 A A -1.3543
227 S A -1.0489
228 T A -1.1671
229 G A -0.9989
230 G A -1.4856
231 A A -0.6523
232 Y A -1.3032
233 E A -2.5947
234 S A -1.9902
235 Y A 0.0000
236 K A -2.0398
237 F A -0.7980
238 I A 0.0000
239 P A -0.8041
240 A A -0.6135
241 L A 0.0000
242 E A -1.8399
243 A A -1.4136
244 A A -1.2151
245 V A 0.0000
246 K A -2.2900
247 Q A -1.9537
248 A A 0.0000
249 Y A -0.2252
250 A A -0.0926
251 A A 0.1022
252 T A 0.0000
253 V A 1.7969
254 A A 0.8355
255 T A -0.0736
256 A A -0.4981
257 P A -1.0996
258 E A -1.9351
259 V A -0.9650
260 K A -0.5557
261 Y A 0.0000
262 T A -0.6470
263 V A 0.0000
264 F A 0.0000
265 E A -0.8987
266 T A -0.4649
267 A A -0.3853
268 L A 0.0000
269 K A -1.2167
270 K A -0.5802
271 A A -0.5505
272 I A 0.0000
273 T A -0.9190
274 A A -0.8554
275 M A -0.8794
276 S A -1.6480
277 E A -2.1382
278 A A -1.4852
279 Q A -1.9288
280 K A -2.8111
281 A A -1.7204
282 A A -1.5318
283 K A -2.2636
284 P A -1.2909
285 A A -0.7210
286 A A -0.2648
287 A A -0.3607
288 A A -0.1926
289 T A -0.0043
290 A A 0.2498
291 T A 0.2298
292 A A 0.4594
293 T A 0.4913
294 A A 0.4602
295 A A 0.7463
296 V A 1.5321
297 G A 0.3053
298 A A 0.2932
299 A A 0.4285
300 T A 0.1255
301 G A -0.2851
302 A A -0.1843
303 A A -0.0678
304 T A -0.1965
305 A A -0.1156
306 A A -0.1166
307 T A -0.3788
308 G A -0.6401
309 G A -0.4947
310 Y A 0.5328
311 K A -0.3647
312 V A 1.2478
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.0187 3.5304 View CSV PDB
4.5 -0.0821 3.5226 View CSV PDB
5.0 -0.1618 3.5179 View CSV PDB
5.5 -0.2377 3.5307 View CSV PDB
6.0 -0.2884 3.5775 View CSV PDB
6.5 -0.2994 3.6612 View CSV PDB
7.0 -0.2702 3.7701 View CSV PDB
7.5 -0.2133 3.892 View CSV PDB
8.0 -0.1425 4.0191 View CSV PDB
8.5 -0.0649 4.1474 View CSV PDB
9.0 0.0176 4.2741 View CSV PDB