Project name: 6c9bd33ce39150a

Status: done

Started: 2026-03-23 13:19:52
Chain sequence(s) A: EVQLVESGGGLVKPGGSLKVSCAASGFSLSSYVLSWVRQTPEKRLEWVATINSLGAITYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARVSNFFFDVWGAGTTVTVSS
B: DIVMTQSHKFMSTSVGDRVSITCKASQDISNDVHWYQEKPGQCPKLLIYGASNRYSGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQSDFFPDTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6c9bd33ce39150a/tmp/folded.pdb                (00:02:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:33)
Show buried residues

Minimal score value
-2.9862
Maximal score value
2.1183
Average score
-0.5259
Total score value
-117.8077

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7973
2 V A -0.6251
3 Q A -0.5562
4 L A 0.0000
5 V A 0.8281
6 E A 0.1629
7 S A -0.5250
8 G A -1.0400
9 G A -0.4782
10 G A 0.2352
11 L A 1.0885
12 V A -0.3726
13 K A -1.9271
14 P A -1.9934
15 G A -1.5955
16 G A -1.0749
17 S A -1.0064
18 L A -0.9022
19 K A -1.9307
20 V A 0.0000
21 S A -0.5198
22 C A 0.0000
23 A A -0.1716
24 A A 0.0000
25 S A -0.6151
26 G A -0.9820
27 F A -0.3577
28 S A -0.4847
29 L A 0.0000
30 S A -0.0677
31 S A 0.1373
32 Y A 0.5176
33 V A 0.9274
34 L A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A 0.0000
41 P A -1.7097
42 E A -2.6564
43 K A -2.2621
44 R A -2.2210
45 L A 0.0000
46 E A -0.8521
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.0000
51 I A 0.0000
52 N A 1.1324
53 S A 1.0095
54 L A 1.6734
55 G A 0.8998
56 A A 1.2685
57 I A 2.1183
58 T A 1.0473
59 Y A 0.6806
60 Y A -0.5340
61 P A 0.0000
62 D A -2.5113
63 S A -1.7841
64 V A 0.0000
65 K A -2.6122
66 G A -1.7464
67 R A -1.4283
68 F A 0.0000
69 T A -0.7287
70 I A 0.0000
71 S A -0.1893
72 R A -0.6687
73 D A -1.2078
74 N A -1.3053
75 A A -1.2859
76 K A -2.1379
77 N A -1.4651
78 T A -0.9158
79 L A 0.0000
80 Y A -0.5096
81 L A 0.0000
82 Q A -1.0936
83 M A 0.0000
84 S A -1.0445
85 S A -1.2553
86 L A 0.0000
87 R A -2.9862
88 S A -2.3197
89 E A -2.5858
90 D A 0.0000
91 T A -0.8241
92 A A 0.0000
93 M A 0.1518
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.3129
99 V A 0.6086
100 S A 0.1706
101 N A -0.1957
102 F A 1.2433
103 F A 0.0000
104 F A 0.0000
105 D A -0.1637
106 V A -0.1188
107 W A 0.0000
108 G A 0.0000
109 A A 0.0457
110 G A 0.0631
111 T A -0.0861
112 T A 0.0746
113 V A 0.0000
114 T A -0.2522
115 V A 0.0000
116 S A -0.9701
117 S A -0.9195
1 D B -0.8823
2 I B 0.0000
3 V B 0.9428
4 M B 0.0000
5 T B -0.5499
6 Q B -0.9003
7 S B -0.8774
8 H B -1.2288
9 K B -1.4460
10 F B 0.3255
11 M B -0.2732
12 S B -0.6190
13 T B 0.0000
14 S B -1.0323
15 V B -0.1994
16 G B -1.5870
17 D B -2.6747
18 R B -2.8979
19 V B 0.0000
20 S B -0.5050
21 I B 0.0000
22 T B -0.8315
23 C B 0.0000
24 K B -1.6259
25 A B 0.0000
26 S B -0.9251
27 Q B -1.8351
28 D B -2.8132
29 I B 0.0000
30 S B -1.7081
31 N B -1.7216
32 D B -0.7285
33 V B 0.0000
34 H B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 E B 0.0000
39 K B -1.2164
40 P B -0.8036
41 G B -1.0239
42 Q B -1.3257
43 C B -0.7360
44 P B 0.0000
45 K B -1.3633
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B -0.2626
50 G B -0.6623
51 A B 0.0000
52 S B -1.0412
53 N B -1.2818
54 R B -1.5180
55 Y B -0.5397
56 S B -0.5070
57 G B -0.7569
58 V B -0.8554
59 P B -1.1982
60 D B -2.1646
61 R B -1.8681
62 L B 0.0000
63 T B -0.9521
64 G B 0.0000
65 S B -0.8872
66 G B -1.2489
67 S B -1.6293
68 G B -1.9644
69 T B -2.2450
70 D B -2.6992
71 F B 0.0000
72 T B -0.7214
73 L B 0.0000
74 T B -0.6751
75 I B 0.0000
76 S B -2.2486
77 N B -2.5348
78 V B 0.0000
79 E B -1.7554
80 S B -1.1357
81 E B -1.8379
82 D B 0.0000
83 L B -0.7952
84 A B 0.0000
85 D B 0.0000
86 Y B 0.0000
87 F B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 S B 0.5901
92 D B 0.0404
93 F B 1.5162
94 F B 1.8772
95 P B 0.5449
96 D B 0.4918
97 T B 0.2948
98 F B 0.0135
99 G B 0.0000
100 G B -1.4768
101 G B 0.0000
102 T B 0.0000
103 K B -0.8604
104 L B 0.0000
105 E B -1.3031
106 I B -0.7103
107 K B -1.6044
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4829 5.6072 View CSV PDB
4.5 -0.5341 5.5126 View CSV PDB
5.0 -0.5932 5.3899 View CSV PDB
5.5 -0.6486 5.2528 View CSV PDB
6.0 -0.689 5.1099 View CSV PDB
6.5 -0.7077 4.9652 View CSV PDB
7.0 -0.7077 4.8201 View CSV PDB
7.5 -0.6968 4.6758 View CSV PDB
8.0 -0.6799 4.5346 View CSV PDB
8.5 -0.657 4.4022 View CSV PDB
9.0 -0.6261 4.2902 View CSV PDB