Project name: 15 ANTIBODY

Status: done

Started: 2026-06-05 10:50:28
Chain sequence(s) A: DIVMTQSPLSLPVTPGEPASISCRSSQSLLNGYNQKNYLTWYLQKPGQSPQLLIYWASTRETGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQNDYSYPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNSYWINWVRQAPGQGLEWMGNIYPSDSYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWRGNSFDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:41)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6dd6876bd963409/tmp/folded.pdb                (00:04:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:31)
Show buried residues

Minimal score value
-3.5469
Maximal score value
1.053
Average score
-0.6941
Total score value
-170.7593

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.2584
2 I A 0.0115
3 V A 0.7320
4 M A 0.0000
5 T A -0.5558
6 Q A 0.0000
7 S A -0.3093
8 P A 0.0910
9 L A 0.6655
10 S A -0.0638
11 L A -0.3481
12 P A -1.1735
13 V A 0.0000
14 T A -1.7367
15 P A -1.9092
16 G A -1.9416
17 E A -2.3242
18 P A -2.2034
19 A A 0.0000
20 S A -0.9121
21 I A 0.0000
22 S A -1.0063
23 C A 0.0000
24 R A -2.3435
25 S A 0.0000
26 S A -0.9258
27 Q A -1.4436
28 S A -0.9288
29 L A 0.0000
30 L A -0.2354
31 N A -0.4776
32 G A -0.4830
33 Y A 0.4401
34 N A -0.6836
35 Q A -1.4859
36 K A -1.2400
37 N A -0.6054
38 Y A -0.1184
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 L A 0.0000
44 Q A -0.8305
45 K A -1.4700
46 P A -1.0510
47 G A -1.4435
48 Q A -1.8773
49 S A -1.1745
50 P A 0.0000
51 Q A -0.8644
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.5288
57 A A 0.0000
58 S A -0.6901
59 T A -0.5442
60 R A -1.2537
61 E A -0.8512
62 T A -0.5730
63 G A -0.8950
64 V A -0.8555
65 P A -1.1945
66 D A -2.2968
67 R A -2.1040
68 F A 0.0000
69 S A -1.4274
70 G A -0.9306
71 S A -0.9622
72 G A -1.1587
73 S A -1.1114
74 G A -1.0270
75 T A -1.6395
76 D A -2.2486
77 F A 0.0000
78 T A -1.2613
79 L A 0.0000
80 K A -2.2082
81 I A 0.0000
82 S A -2.4060
83 R A -3.3085
84 V A 0.0000
85 E A -2.4403
86 A A -1.7248
87 E A -2.4003
88 D A 0.0000
89 V A -1.0296
90 G A 0.0000
91 V A -0.2411
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A 0.6469
99 S A 0.3910
100 Y A 0.5070
101 P A -0.2391
102 F A 0.0000
103 T A 0.1776
104 F A 0.1085
105 G A 0.0000
106 Q A -1.0816
107 G A 0.0000
108 T A 0.0000
109 K A -0.6998
110 L A 0.0000
111 E A -1.7593
112 I A -1.6706
113 K A -2.4164
114 G A -1.8117
115 G A -1.7143
116 G A -1.3537
117 G A -1.4667
118 S A -1.0835
119 G A -1.5774
120 G A -1.5228
121 G A -1.7186
122 G A -1.5474
123 S A -1.1126
124 G A -1.2279
125 G A -1.2223
126 G A -1.3430
127 G A -1.3905
128 S A -1.3330
129 Q A -1.7890
130 V A 0.0000
131 Q A -1.5025
132 L A 0.0000
133 V A 0.1940
134 Q A 0.0000
135 S A -0.4692
136 G A -0.4380
137 A A 0.3205
138 E A 0.0657
139 V A 1.0416
140 K A -0.9195
141 K A -2.1071
142 P A -2.1178
143 G A -1.4640
144 A A -1.1633
145 S A -1.3184
146 V A 0.0000
147 K A -2.0597
148 V A 0.0000
149 S A -0.6156
150 C A 0.0000
151 K A -0.8082
152 A A 0.0000
153 S A -0.8011
154 G A -0.9429
155 Y A -0.4585
156 T A -0.3091
157 F A 0.0000
158 N A -1.2837
159 S A -0.3312
160 Y A 0.2112
161 W A 0.4848
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A -0.3412
167 Q A -0.5876
168 A A -0.9346
169 P A -0.9292
170 G A -1.2113
171 Q A -1.8637
172 G A -1.2914
173 L A 0.0000
174 E A -0.7187
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A 0.0542
181 P A 0.0000
182 S A -1.2206
183 D A -1.6646
184 S A -0.5774
185 Y A 0.7574
186 T A 0.4411
187 N A 0.0192
188 Y A -1.0919
189 N A 0.0000
190 Q A -2.8528
191 K A -3.0458
192 F A 0.0000
193 K A -3.5469
194 D A -3.2639
195 R A -2.2971
196 V A 0.0000
197 T A -1.1283
198 M A 0.0000
199 T A -0.3519
200 R A -1.3216
201 D A -1.1224
202 T A -0.8794
203 S A -0.5579
204 T A -0.6409
205 S A -0.8458
206 T A 0.0000
207 V A 0.0000
208 Y A -0.7725
209 M A 0.0000
210 E A -1.6097
211 L A 0.0000
212 S A -1.2758
213 S A -1.1913
214 L A 0.0000
215 R A -2.7238
216 S A -2.2295
217 E A -2.4597
218 D A 0.0000
219 T A -0.6879
220 A A 0.0000
221 V A 0.4948
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 S A 0.0000
228 W A -0.2956
229 R A -1.3619
230 G A -0.7388
231 N A -0.5299
232 S A 0.0000
233 F A 0.0000
234 D A -0.3502
235 Y A -0.1148
236 W A -0.3139
237 G A 0.0000
238 Q A -1.1804
239 G A -0.3487
240 T A 0.0000
241 L A 1.0530
242 V A 0.0000
243 T A -0.0510
244 V A 0.0000
245 S A -1.0624
246 S A -1.1553
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6115 1.8947 View CSV PDB
4.5 -0.6493 1.876 View CSV PDB
5.0 -0.6943 1.845 View CSV PDB
5.5 -0.7382 1.8061 View CSV PDB
6.0 -0.7718 1.7656 View CSV PDB
6.5 -0.7879 1.7299 View CSV PDB
7.0 -0.7855 1.7048 View CSV PDB
7.5 -0.77 1.6919 View CSV PDB
8.0 -0.7465 1.6868 View CSV PDB
8.5 -0.7167 1.685 View CSV PDB
9.0 -0.6814 1.6844 View CSV PDB