Project name: 6e460318bcf8014

Status: done

Started: 2026-03-12 19:35:35
Chain sequence(s) A: MEPRIQKEYYYNLHENNSQANHNKFHEMPEYDDQLPDFPHKQLEEEQNPFHKLSEVLNSGSVVPLWLVNPIYYVLELFPRAISYYFNAEAAAKEAAAKAFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:44)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6e460318bcf8014/tmp/folded.pdb                (00:03:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:17)
Show buried residues

Minimal score value
-3.9409
Maximal score value
4.0016
Average score
-0.716
Total score value
-172.5611

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -1.1066
2 E A 0.0000
3 P A 0.0000
4 R A -2.3214
5 I A -2.1272
6 Q A -2.5503
7 K A -2.5416
8 E A -2.2820
9 Y A -0.5138
10 Y A 0.1412
11 Y A 0.1014
12 N A -1.1478
13 L A -0.5000
14 H A -2.0290
15 E A -3.3035
16 N A -3.3372
17 N A -3.1133
18 S A -2.5730
19 Q A -2.5996
20 A A -1.8858
21 N A -2.6253
22 H A -2.5685
23 N A -2.6025
24 K A -2.3451
25 F A -0.3287
26 H A -1.3483
27 E A -1.9220
28 M A -0.4207
29 P A -1.2001
30 E A -2.0245
31 Y A -1.0810
32 D A -2.6834
33 D A -2.6823
34 Q A -1.9391
35 L A -0.0949
36 P A -0.4300
37 D A -0.9434
38 F A 0.6230
39 P A -0.9694
40 H A -1.8356
41 K A -2.3976
42 Q A -2.2971
43 L A -1.2840
44 E A -3.1218
45 E A -3.8212
46 E A -3.9409
47 Q A -3.3010
48 N A -2.4358
49 P A -0.8911
50 F A 0.6950
51 H A -1.1499
52 K A -1.2666
53 L A 0.9615
54 S A -0.1001
55 E A -1.0625
56 V A 1.2276
57 L A 1.2329
58 N A -0.7847
59 S A -0.3039
60 G A 0.3064
61 S A 0.6851
62 V A 2.5723
63 V A 3.0205
64 P A 2.7425
65 L A 3.3218
66 W A 2.8943
67 L A 2.6247
68 V A 2.2356
69 N A 1.3632
70 P A 2.1102
71 I A 3.3187
72 Y A 3.4638
73 Y A 3.7112
74 V A 4.0016
75 L A 3.4486
76 E A 1.5308
77 L A 2.7667
78 F A 3.0673
79 P A 1.1684
80 R A 0.2866
81 A A 1.7511
82 I A 2.9049
83 S A 1.6536
84 Y A 2.0560
85 Y A 2.3864
86 F A 2.1907
87 N A 0.2763
88 A A 0.1222
89 E A -0.9168
90 A A -1.0930
91 A A -1.2073
92 A A -1.6470
93 K A -3.1707
94 E A -3.1038
95 A A -1.7010
96 A A -1.4858
97 A A -1.4397
98 K A -2.4705
99 A A -1.2691
100 F A -1.1776
101 D A -2.3380
102 A A 0.0000
103 S A -2.1784
104 N A -2.4319
105 F A 0.0000
106 K A -2.1896
107 D A -1.1007
108 F A -0.3673
109 S A -0.6181
110 S A -0.9337
111 I A 0.0000
112 A A -0.4877
113 S A -0.5958
114 A A -0.7872
115 S A -0.6978
116 S A 0.0000
117 S A -0.1668
118 W A 0.0000
119 Q A -1.1130
120 N A 0.0000
121 Q A -1.7598
122 S A -1.2874
123 G A -1.2770
124 S A 0.0000
125 T A -0.8560
126 M A 0.0000
127 I A -0.1901
128 I A 0.0000
129 Q A -1.6320
130 V A 0.0000
131 D A -0.8257
132 S A 0.3018
133 F A 1.0968
134 G A 0.0000
135 N A -1.1280
136 V A 0.0000
137 S A -1.2625
138 G A -0.8759
139 Q A -0.9412
140 Y A 0.0000
141 V A 0.0000
142 N A 0.0000
143 R A -2.5684
144 A A 0.0000
145 Q A -2.1435
146 G A -1.7668
147 T A -1.8707
148 G A -2.0374
149 C A 0.0000
150 Q A -2.5713
151 N A -2.2320
152 S A -1.5810
153 P A -1.2093
154 Y A 0.0000
155 P A -0.9342
156 L A 0.0000
157 T A -0.9959
158 G A -1.3450
159 R A -1.9595
160 V A 0.0000
161 N A -1.0093
162 G A -0.5264
163 T A 0.0673
164 F A 1.0554
165 I A 0.0000
166 A A -0.4508
167 F A 0.0000
168 S A -0.6544
169 V A 0.0000
170 G A -1.1543
171 W A 0.0000
172 N A -2.5593
173 N A -1.6577
174 S A -1.0755
175 T A -1.3423
176 E A -2.1380
177 N A -2.4628
178 C A -2.1411
179 N A -2.2405
180 S A -1.3229
181 A A -0.4039
182 T A 0.0000
183 G A -0.5927
184 W A 0.0000
185 T A -0.0779
186 G A 0.0000
187 Y A 1.2537
188 A A 0.0000
189 Q A -0.7817
190 V A -1.4099
191 N A -1.8815
192 G A -1.7191
193 N A -2.2520
194 N A -1.7462
195 T A 0.0000
196 E A -0.7324
197 I A 0.0000
198 V A 0.1808
199 T A 0.0000
200 S A -0.9299
201 W A 0.0000
202 N A -1.0433
203 L A 0.0000
204 A A -0.2173
205 Y A -1.0375
206 E A -2.0232
207 G A -1.3906
208 G A -1.2785
209 S A -0.8774
210 G A -1.0608
211 P A -0.8806
212 A A -0.1312
213 I A 0.8725
214 E A -0.6911
215 Q A -1.7242
216 G A -1.6723
217 Q A -1.7315
218 D A 0.0000
219 T A -0.7381
220 F A 0.0000
221 Q A -0.9680
222 Y A -0.0440
223 V A 0.3470
224 P A -0.3882
225 T A -0.6901
226 T A -1.5728
227 E A -3.0327
228 N A -2.8157
229 K A -2.5028
230 S A -0.8979
231 L A 0.7947
232 L A 0.7109
233 K A -1.7635
234 D A -2.5866
235 T A -2.0880
236 H A -2.7349
237 H A -2.7120
238 H A -2.6475
239 H A -2.6684
240 H A -2.3802
241 H A -1.8787
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.2251 6.1844 View CSV PDB
4.5 -0.3023 6.1101 View CSV PDB
5.0 -0.3938 6.0484 View CSV PDB
5.5 -0.4779 6.0484 View CSV PDB
6.0 -0.5325 6.0484 View CSV PDB
6.5 -0.5473 6.0484 View CSV PDB
7.0 -0.5314 6.0484 View CSV PDB
7.5 -0.5017 6.0484 View CSV PDB
8.0 -0.4663 6.0484 View CSV PDB
8.5 -0.4257 6.0484 View CSV PDB
9.0 -0.3794 6.0484 View CSV PDB