Project name: 5_docked

Status: done

Started: 2026-06-26 07:35:08
Chain sequence(s) A: RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
B: MKIRHLGESFWKPG
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:34)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6e7b36f5267e511/tmp/folded.pdb                (00:02:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:10)
Show buried residues

Minimal score value
-3.9612
Maximal score value
1.1432
Average score
-0.7196
Total score value
-166.9416

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
217 R A -0.0284
218 S A 0.0000
219 V A 0.0000
220 A A -0.0133
221 S A -0.4480
222 S A -0.6046
223 K A -1.2067
224 L A 0.0000
225 W A 0.2190
226 M A 0.0000
227 L A 0.0673
228 E A -0.4060
229 F A 0.0000
230 S A 0.0000
231 A A 0.0376
232 F A 0.0000
233 L A 0.0000
234 E A -0.8381
235 Q A 0.0000
236 Q A -2.3635
237 Q A -2.8352
238 D A -3.1642
239 P A -2.2214
240 D A -2.5578
241 T A -1.7868
242 Y A -0.8961
243 N A -1.3650
244 K A -1.2526
245 H A -1.1451
246 L A -0.3108
247 F A 0.0000
248 V A 0.0000
249 H A -0.3989
250 I A 0.0000
251 G A -0.5384
252 Q A -0.8554
253 S A -0.7283
254 S A -0.5528
255 P A -0.3432
256 S A 0.1481
257 Y A 0.9547
258 S A 0.4772
259 D A 0.2326
260 P A 0.1759
261 Y A 0.9413
262 L A 0.0998
263 E A -0.5463
264 A A -0.5650
265 V A -0.9796
266 D A -2.1465
267 I A 0.0000
268 R A -3.4198
269 Q A -2.8079
270 I A 0.0000
271 Y A -2.1892
272 D A -2.4319
273 K A -1.2244
274 F A 0.0000
275 P A -2.4152
276 E A -3.9612
277 K A -3.7061
278 K A -3.2408
279 G A -2.1560
280 G A 0.0000
281 L A 0.0000
282 K A -3.3611
283 D A -3.0148
284 L A -1.9760
285 F A -1.9845
286 E A -3.2145
287 R A -2.9601
288 G A -1.8628
289 P A -1.1888
290 S A -1.2407
291 N A -0.7549
292 A A 0.0000
293 F A 0.0000
294 F A 0.0000
295 L A 0.0000
296 V A 0.0000
297 K A 0.0000
298 F A 0.0000
299 W A 0.0000
300 A A 0.0000
301 D A -0.7646
302 L A 0.0000
303 N A -1.3895
304 T A 0.0000
305 N A -1.4236
306 I A -0.0794
307 E A -1.5571
308 D A -1.4978
309 E A -1.3553
310 G A -1.2179
311 S A -1.2925
312 S A -0.6550
313 F A 0.0354
314 Y A 0.0000
315 G A 0.0000
316 V A -0.2288
317 S A 0.0000
318 S A 0.0000
319 Q A 0.0000
320 Y A 0.0000
321 E A -1.0564
322 S A 0.0000
323 P A -1.6150
324 E A -2.5960
325 N A -2.0234
326 M A -1.1753
327 I A -0.1832
328 I A 0.0000
329 T A -0.2646
330 C A 0.0000
331 S A 0.3346
332 T A 0.0414
333 K A -0.2959
334 V A 0.0000
335 C A 0.0000
336 S A 0.1362
337 F A 0.6705
338 G A -1.0493
339 K A -1.6161
340 Q A -0.7167
341 V A 0.6052
342 V A -0.0107
343 E A -0.1759
344 K A 0.0060
345 V A 1.1432
346 E A 0.1676
347 T A 0.0390
348 E A -0.2833
349 Y A 0.6786
350 A A -0.7997
351 R A -1.7727
352 Y A -0.9775
353 E A -2.0916
354 N A -2.1623
355 G A -1.4397
356 H A -2.0820
357 Y A -1.5256
358 S A 0.0000
359 Y A 0.0000
360 R A -1.4207
361 I A 0.0000
362 H A -1.7132
363 R A -1.5307
364 S A -0.9134
365 P A -0.6505
366 L A -0.1230
367 C A -0.5713
368 E A -1.4478
369 Y A -0.2706
370 M A -0.3325
371 I A -0.4426
372 N A -1.2798
373 F A 0.0000
374 I A -0.8111
375 H A -1.3434
376 K A -2.0389
377 L A 0.0000
378 K A -1.3631
379 H A -1.3808
380 L A -0.9105
381 P A -0.7405
382 E A -0.9882
383 K A -0.6662
384 Y A 0.8024
385 M A 0.5096
386 M A 0.0000
387 N A 0.0000
388 S A 0.4027
389 V A 0.5645
390 L A 0.0000
391 E A -0.0256
392 N A -0.2167
393 F A 0.0000
394 T A 0.0000
395 I A 0.0198
396 L A 0.0000
397 Q A 0.0000
398 V A 0.3789
399 V A 0.0000
400 T A 0.0000
401 N A -1.7570
402 R A -2.2244
403 D A -2.6201
404 T A -1.8669
405 Q A -2.3283
406 E A -1.8206
407 T A 0.0000
408 L A 0.0000
409 L A 0.0000
410 C A 0.0000
411 I A 0.0000
412 A A 0.0000
413 Y A 0.0000
414 V A 0.0000
415 F A 0.0000
416 E A 0.0000
417 V A 0.0000
418 S A 0.0000
419 A A -0.8585
420 S A -1.3414
421 E A -2.3199
422 H A -2.0035
423 G A -1.4528
424 A A 0.0000
425 Q A -0.8311
426 H A -0.5696
427 H A -0.3876
428 I A 0.0000
429 Y A 0.0000
430 R A -0.5616
431 L A 0.0000
432 V A -1.3637
433 K A -3.2364
434 E A -3.0071
1 M B 0.0726
2 K B -1.2825
3 I B -0.6060
4 R B -0.6513
5 H B -0.7414
6 L B 0.1515
7 G B 0.0000
8 E B -0.9697
9 S B -0.4504
10 F B 0.4366
11 W B -0.3850
12 K B -1.2816
13 P B -0.9559
14 G B -0.8529
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6337 2.8239 View CSV PDB
4.5 -0.6953 2.7624 View CSV PDB
5.0 -0.7696 2.6899 View CSV PDB
5.5 -0.8388 2.6314 View CSV PDB
6.0 -0.8862 2.6124 View CSV PDB
6.5 -0.9025 2.6399 View CSV PDB
7.0 -0.8901 2.6991 View CSV PDB
7.5 -0.8607 2.7734 View CSV PDB
8.0 -0.8235 2.8548 View CSV PDB
8.5 -0.7812 2.9423 View CSV PDB
9.0 -0.7338 3.0408 View CSV PDB