Project name: mutant 4 full

Status: done

Started: 2026-06-05 10:14:44
Chain sequence(s) A: EIVMTQSPATLSLSPGERATLSCRSSQSLLNSGNQKNYLTWYQQKPGQAPRLLIYWASTRETGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQNDYSYPFTFGQGTQVEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNSYYINWVRQAPGQGLEWMGNIYPSDSYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWRGNSFDYWGQGTLVTVSS
B: DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:45)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/6f33fe172e735e2/tmp/folded.pdb                (00:02:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:24)
Show buried residues

Minimal score value
-3.5361
Maximal score value
2.8188
Average score
-0.554
Total score value
-165.6509

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.5056
2 I A -0.2029
3 V A 0.9014
4 M A 0.0000
5 T A -0.3217
6 Q A 0.0000
7 S A -0.4301
8 P A -0.1744
9 A A -0.2830
10 T A -0.2033
11 L A -0.2166
12 S A -0.5285
13 L A -1.2606
14 S A -1.7795
15 P A -1.9808
16 G A -1.7872
17 E A -2.4686
18 R A -2.7375
19 A A 0.0000
20 T A -0.6469
21 L A 0.0000
22 S A -0.6779
23 C A 0.0000
24 R A -1.4199
25 S A 0.0000
26 S A -0.7630
27 Q A -1.4212
28 S A -0.9442
29 L A 0.0000
30 L A -0.3880
31 N A -0.9988
32 S A -0.9699
33 G A -1.2714
34 N A -1.4311
35 Q A -1.7192
36 K A -1.3892
37 N A 0.0000
38 Y A 0.0000
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.4652
44 Q A 0.0000
45 K A -1.3520
46 P A -0.9746
47 G A -1.4572
48 Q A -2.0630
49 A A -1.2591
50 P A 0.0000
51 R A -1.0336
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.3818
57 A A 0.0000
58 S A -0.6329
59 T A -0.4838
60 R A -0.8215
61 E A 0.0000
62 T A -0.4214
63 G A -0.6587
64 I A -0.4126
65 P A -0.3649
66 A A -0.3472
67 R A -0.7167
68 F A 0.0000
69 S A -0.5098
70 G A -0.4967
71 S A -0.7863
72 G A -1.2335
73 S A -1.1649
74 G A -1.1477
75 T A -1.5813
76 D A -2.4590
77 F A 0.0000
78 T A -0.7787
79 L A 0.0000
80 T A -0.6331
81 I A 0.0000
82 S A -1.4856
83 S A -1.7219
84 L A 0.0000
85 Q A -1.8238
86 P A -1.9461
87 E A -2.2941
88 D A 0.0000
89 F A -0.5482
90 A A 0.0000
91 V A -0.0047
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A -0.0240
99 S A -0.4571
100 Y A -0.4088
101 P A -0.5964
102 F A 0.0000
103 T A 0.0661
104 F A 0.1021
105 G A 0.0000
106 Q A -1.2881
107 G A 0.0000
108 T A 0.0000
109 Q A -0.4540
110 V A 0.0000
111 E A -0.9068
112 I A 0.0000
113 K A -2.2507
114 G A -1.8025
115 G A -1.9041
116 G A -1.4563
117 G A -1.5310
118 S A -1.2922
119 G A -1.5290
120 G A -1.6102
121 G A -1.7266
122 G A -1.6056
123 S A -1.1625
124 G A -1.3170
125 G A -1.2375
126 G A -1.3746
127 G A -1.4673
128 S A -1.4155
129 Q A -1.8207
130 V A -1.2045
131 Q A -1.7427
132 L A 0.0000
133 V A -0.5950
134 Q A 0.0000
135 S A -0.6158
136 G A -0.5209
137 A A 0.3140
138 E A 0.1665
139 V A 1.0762
140 Q A -0.8321
141 K A -2.1402
142 P A -2.2842
143 G A -1.6155
144 A A -1.2571
145 S A -1.2909
146 V A 0.0000
147 K A -1.5549
148 V A 0.0000
149 S A -0.6913
150 C A 0.0000
151 K A -1.4419
152 A A 0.0000
153 S A -1.0586
154 G A -1.1002
155 Y A -0.4616
156 T A -0.1825
157 F A 0.0000
158 N A -0.5183
159 S A -0.0641
160 Y A 0.1141
161 Y A 0.0000
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A -0.3115
167 Q A -0.5540
168 A A -0.9288
169 P A -0.9335
170 G A -1.2118
171 Q A -1.8863
172 G A -1.3313
173 L A 0.0000
174 E A -0.7314
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A 0.0000
181 P A 0.0000
182 S A 0.1071
183 D A 0.1357
184 S A -0.1540
185 Y A -0.1386
186 T A -0.0081
187 N A -0.3128
188 Y A -1.1313
189 N A 0.0000
190 Q A -3.0693
191 K A -3.0520
192 F A 0.0000
193 K A -3.5361
194 D A -3.2905
195 R A -2.3563
196 V A 0.0000
197 T A -1.0663
198 M A 0.0000
199 T A -0.4705
200 R A -1.0439
201 D A -1.0700
202 T A -0.5416
203 S A -0.5222
204 T A -0.7032
205 S A -0.8678
206 T A 0.0000
207 V A 0.0000
208 Y A -0.6820
209 M A 0.0000
210 E A -1.3528
211 L A 0.0000
212 S A -1.3295
213 S A -1.4339
214 L A 0.0000
215 R A -3.1395
216 S A -2.4034
217 E A -2.5741
218 D A 0.0000
219 T A -0.7376
220 A A 0.0000
221 V A 0.5328
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 S A 0.0000
228 W A 0.0032
229 R A -0.5448
230 G A 0.0000
231 N A 0.0000
232 S A 0.0000
233 F A 0.0000
234 D A 0.0000
235 Y A -0.1341
236 W A -0.4347
237 G A 0.0000
238 Q A -1.3932
239 G A -0.5301
240 T A 0.0000
241 L A 0.9894
242 V A 0.0000
243 T A -0.0616
244 V A 0.0000
245 S A -0.8886
246 S A -0.9919
1 D B -2.4540
2 Q B -2.0089
3 W B -1.1361
4 S B -1.4093
5 T B -0.9123
6 Q B -1.3064
7 D B -0.8123
8 L B 0.1283
9 Y B -0.0681
10 N B -1.2031
11 N B 0.0000
12 P B -0.8323
13 V B 0.0000
14 T B 0.0000
15 A B 0.0000
16 V B 0.0000
17 F B 0.0000
18 N B -0.8704
19 Y B 0.0000
20 Q B -1.4464
21 G B -0.7341
22 L B 0.3024
23 W B 0.0039
24 R B 0.0000
25 S B 0.0000
26 C B 0.0000
27 V B 0.0000
28 R B -1.0877
29 E B -1.7794
30 S B -1.0240
31 S B -0.6326
32 G B -0.5459
33 F B 0.7472
34 T B -0.3797
35 E B -0.9326
36 C B -0.9091
37 R B -1.5014
38 G B -0.0195
39 Y B 1.1751
40 F B 2.4485
41 T B 2.3618
42 L B 2.7897
43 L B 2.8188
44 G B 1.9482
45 L B 2.5088
46 P B 1.5737
47 A B 1.0348
48 M B 0.9863
49 L B 0.4171
50 Q B -0.5913
51 A B -0.2157
52 V B 0.6171
53 R B -1.1603
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3899 5.0574 View CSV PDB
4.5 -0.4206 5.0409 View CSV PDB
5.0 -0.4574 5.0243 View CSV PDB
5.5 -0.4935 5.0078 View CSV PDB
6.0 -0.5215 4.9914 View CSV PDB
6.5 -0.536 4.9754 View CSV PDB
7.0 -0.5364 4.9608 View CSV PDB
7.5 -0.5271 4.9492 View CSV PDB
8.0 -0.5124 4.9421 View CSV PDB
8.5 -0.4941 4.9388 View CSV PDB
9.0 -0.4724 4.9375 View CSV PDB