Project name: ok 1

Status: done

Started: 2026-03-17 06:53:08
Chain sequence(s) A: EIVLTQSPATLSLSPGEKVTLTCSASQSVSYMNWYQQKPGTAPRLWIYDTSNLATGIPARFSGSGSGRDFTLTISSLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNRYTMHWVRQAPGQGLWMGYINPSRGYTNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:19)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:20)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:20)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/72d5b3a8f597988/tmp/folded.pdb                (00:04:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:40)
Show buried residues

Minimal score value
-3.615
Maximal score value
1.012
Average score
-0.7402
Total score value
-176.9191

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8459
2 I A 0.0000
3 V A 1.0120
4 L A 0.0000
5 T A -0.0054
6 Q A 0.0000
7 S A -0.4036
8 P A -0.2978
9 A A -0.3835
10 T A -0.4670
11 L A -0.4126
12 S A -0.9389
13 L A -0.9634
14 S A -1.3052
15 P A -1.4630
16 G A -1.5956
17 E A -1.9716
18 K A -2.3083
19 V A 0.0000
20 T A -0.4733
21 L A 0.0000
22 T A -0.5570
23 C A 0.0000
24 S A -1.3455
25 A A 0.0000
26 S A -0.9929
27 Q A -1.9940
28 S A -1.9587
29 V A 0.0000
30 S A -0.8106
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 Q A 0.0000
37 Q A 0.0000
38 K A -1.1851
39 P A -0.7277
40 G A -0.8396
41 T A -1.0555
42 A A -0.8865
43 P A 0.0000
44 R A -1.5682
45 L A 0.0000
46 W A -0.3131
47 I A 0.0000
48 Y A -0.3955
49 D A -1.3688
50 T A -0.9562
51 S A -0.8290
52 N A -0.7876
53 L A -0.0291
54 A A -0.3468
55 T A -0.2093
56 G A -0.3751
57 I A -0.0141
58 P A -0.0990
59 A A -0.1087
60 R A -0.7001
61 F A 0.0000
62 S A -0.3569
63 G A -0.5419
64 S A -0.9611
65 G A -1.4518
66 S A -1.5408
67 G A -2.0227
68 R A -3.2426
69 D A -3.0581
70 F A 0.0000
71 T A -0.6671
72 L A 0.0000
73 T A -0.5658
74 I A 0.0000
75 S A -1.3411
76 S A -1.6116
77 L A 0.0000
78 E A -1.9215
79 P A -1.7247
80 E A -2.4607
81 D A 0.0000
82 F A -0.9948
83 A A 0.0000
84 V A -0.3440
85 Y A 0.0000
86 Y A -0.1573
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0522
91 S A -0.2713
92 S A -1.2489
93 N A -1.7489
94 P A -1.5881
95 F A 0.0000
96 T A 0.0000
97 F A 0.3632
98 G A 0.0000
99 Q A -0.7965
100 G A 0.0000
101 T A 0.0000
102 K A -1.0168
103 L A 0.0000
104 E A -1.4036
105 I A -0.9961
106 K A -2.0594
107 G A -1.5916
108 G A -1.4522
109 G A -1.3281
110 G A -1.3439
111 S A -0.9971
112 G A -1.5106
113 G A -1.6617
114 G A -1.5475
115 G A -1.5722
116 S A -1.0094
117 G A -1.2086
118 G A -1.1125
119 G A -1.2677
120 G A -1.3746
121 S A -1.3044
122 Q A -1.7556
123 V A 0.0000
124 Q A -1.3275
125 L A 0.0000
126 V A 0.2697
127 Q A 0.0000
128 S A -0.5474
129 G A -0.6463
130 A A -0.1061
131 E A -0.1922
132 V A 0.8716
133 K A -0.8626
134 K A -2.0570
135 P A -2.0385
136 G A -1.4445
137 A A -1.1549
138 S A -1.2741
139 V A 0.0000
140 K A -1.7446
141 V A 0.0000
142 S A -0.5477
143 C A 0.0000
144 K A -0.7797
145 A A 0.0000
146 S A -0.7234
147 G A -0.9065
148 Y A -0.6854
149 T A -0.7860
150 F A 0.0000
151 N A -2.1630
152 R A -2.3877
153 Y A -1.2178
154 T A -0.7694
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.3086
161 A A -0.6842
162 P A -0.7526
163 G A -1.1616
164 Q A -1.1342
165 G A -0.4895
166 L A -0.2522
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.0119
171 I A 0.0000
172 N A -0.9828
173 P A 0.0000
174 S A -1.6939
175 R A -1.7338
176 G A -0.8143
177 Y A 0.3491
178 T A -0.1368
179 N A -1.0812
180 Y A -1.6858
181 A A -2.0192
182 Q A -2.9388
183 K A -3.0095
184 F A 0.0000
185 K A -3.6150
186 D A -3.2676
187 R A -2.2056
188 V A 0.0000
189 T A -1.2249
190 M A 0.0000
191 T A -0.4587
192 R A -1.1473
193 D A -1.1247
194 T A -0.8639
195 S A -0.5603
196 T A -0.6518
197 S A -0.8479
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7284
201 M A 0.0000
202 E A -1.5470
203 L A 0.0000
204 S A -1.2743
205 S A -1.2319
206 L A 0.0000
207 R A -2.6051
208 S A -2.1574
209 E A -2.3817
210 D A 0.0000
211 T A -0.8243
212 A A 0.0000
213 V A 0.1377
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.0264
221 D A -2.3512
222 D A -2.4898
223 H A -1.4418
224 Y A -0.3029
225 C A 0.0000
226 L A 0.0000
227 D A -0.3468
228 Y A -0.3153
229 W A -0.4035
230 G A 0.0000
231 Q A -1.0692
232 G A -0.4687
233 T A 0.0000
234 T A -0.0018
235 V A 0.0000
236 T A -0.3028
237 V A 0.0000
238 S A -0.8510
239 S A -1.1312
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6991 1.6275 View CSV PDB
4.5 -0.7403 1.6275 View CSV PDB
5.0 -0.7887 1.6275 View CSV PDB
5.5 -0.8356 1.6275 View CSV PDB
6.0 -0.872 1.6282 View CSV PDB
6.5 -0.8908 1.6667 View CSV PDB
7.0 -0.8917 1.7078 View CSV PDB
7.5 -0.8805 1.7496 View CSV PDB
8.0 -0.8622 1.7916 View CSV PDB
8.5 -0.838 1.8328 View CSV PDB
9.0 -0.807 1.8719 View CSV PDB