Project name: 73111a53f02161a

Status: done

Started: 2025-02-21 07:17:13
Chain sequence(s) A: MGTPSYDIKNKGDDMQEEPKVKLHHEKGGDEKEKIIEKETPSQDINNKDTISSYVLRDDTQEIPKMEHEEGGYVKEKIVEKETISQYIIKIEGDDDAQEKLKVEYEEEEYEKEKIVEKETPSQDINNKGDDAQEKPKVEHEEGDDKETPSQDIIKMEGEGALEITKVVCEKIIVREDLAVQSKPPSKRDPPKMQTDNNKL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)
Show buried residues

Minimal score value
-4.4959
Maximal score value
2.5186
Average score
-1.6371
Total score value
-327.4113

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.7802
2 G A -0.0817
3 T A -0.0636
4 P A -0.2406
5 S A 0.0521
6 Y A 0.6225
7 D A -0.9331
8 I A 0.0445
9 K A -2.2574
10 N A -2.9043
11 K A -3.4911
12 G A -3.0964
13 D A -3.3903
14 D A -2.9518
15 M A -1.3244
16 Q A -2.6553
17 E A -3.5655
18 E A -3.4147
19 P A -2.3531
20 K A -2.0556
21 V A 0.0927
22 K A -1.0191
23 L A 0.0618
24 H A -1.6203
25 H A -2.6301
26 E A -3.2848
27 K A -3.4569
28 G A -2.8817
29 G A -2.5279
30 D A -3.9590
31 E A -4.1155
32 K A -4.1975
33 E A -3.2060
34 K A -1.6845
35 I A 0.5527
36 I A 0.5693
37 E A -1.8647
38 K A -2.6161
39 E A -3.0878
40 T A -2.0720
41 P A -1.6102
42 S A -1.4212
43 Q A -1.8286
44 D A -1.9915
45 I A -0.4491
46 N A -2.1781
47 N A -2.8868
48 K A -3.3159
49 D A -2.7853
50 T A -0.5891
51 I A 1.6047
52 S A 1.2696
53 S A 1.4419
54 Y A 2.3259
55 V A 2.3349
56 L A 0.9349
57 R A -1.5956
58 D A -3.1892
59 D A -3.4530
60 T A -2.1155
61 Q A -2.2585
62 E A -1.9590
63 I A 0.3891
64 P A -0.6952
65 K A -1.6887
66 M A -0.9600
67 E A -3.0333
68 H A -3.2526
69 E A -3.7496
70 E A -3.3512
71 G A -1.6401
72 G A -0.6060
73 Y A 1.0616
74 V A 0.1721
75 K A -2.7346
76 E A -2.7550
77 K A -1.7744
78 I A 1.1463
79 V A 0.2943
80 E A -2.7390
81 K A -3.8920
82 E A -3.1882
83 T A -0.9539
84 I A 0.8781
85 S A -0.2480
86 Q A -0.4922
87 Y A 1.4771
88 I A 2.4098
89 I A 2.5186
90 K A 0.3202
91 I A 0.6070
92 E A -1.8315
93 G A -3.2126
94 D A -4.0112
95 D A -4.2077
96 D A -3.7077
97 A A -3.2196
98 Q A -3.2238
99 E A -3.7833
100 K A -2.5854
101 L A -1.0470
102 K A -1.9485
103 V A -0.1810
104 E A -1.0783
105 Y A -0.3415
106 E A -2.5181
107 E A -3.3633
108 E A -3.6027
109 E A -3.2264
110 Y A -1.6283
111 E A -3.6340
112 K A -4.1364
113 E A -3.7556
114 K A -2.4003
115 I A 0.6848
116 V A 0.7601
117 E A -2.1733
118 K A -3.4713
119 E A -3.2646
120 T A -2.1551
121 P A -1.6446
122 S A -1.5011
123 Q A -1.8057
124 D A -2.1160
125 I A -0.3865
126 N A -2.0939
127 N A -2.9137
128 K A -3.1437
129 G A -3.0740
130 D A -3.5498
131 D A -3.4778
132 A A -2.5775
133 Q A -3.2106
134 E A -3.7954
135 K A -3.2827
136 P A -2.2688
137 K A -2.3496
138 V A -0.7879
139 E A -2.7548
140 H A -3.1078
141 E A -3.8551
142 E A -4.0974
143 G A -3.6981
144 D A -4.2456
145 D A -4.4959
146 K A -4.1110
147 E A -3.7022
148 T A -2.2360
149 P A -1.8258
150 S A -1.5341
151 Q A -1.2691
152 D A -1.1309
153 I A 1.3112
154 I A 1.5151
155 K A -0.4399
156 M A -0.1263
157 E A -2.2354
158 G A -2.0450
159 E A -2.3579
160 G A -1.2289
161 A A 0.2899
162 L A 1.0593
163 E A 0.2651
164 I A 1.2933
165 T A 0.6030
166 K A 0.1578
167 V A 2.0041
168 V A 1.9510
169 C A -0.0086
170 E A -2.0432
171 K A -1.2180
172 I A 1.8280
173 I A 2.4390
174 V A 1.3518
175 R A -1.8571
176 E A -3.0353
177 D A -2.0875
178 L A 0.4665
179 A A 0.5142
180 V A 1.1502
181 Q A -0.7084
182 S A -1.1616
183 K A -2.1136
184 P A -1.7241
185 P A -1.6690
186 S A -2.2055
187 K A -3.3079
188 R A -3.7313
189 D A -3.5973
190 P A -2.2460
191 P A -1.7719
192 K A -1.9781
193 M A -0.7155
194 Q A -1.9013
195 T A -1.9893
196 D A -3.2682
197 N A -3.2538
198 N A -2.8441
199 K A -2.1941
200 L A 0.1815
Download PDB file
View in 3Dmol