Project name: 74cf6a4da1b8a38

Status: done

Started: 2026-06-12 09:54:03
Chain sequence(s) A: HPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:06)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/74cf6a4da1b8a38/tmp/folded.pdb                (00:04:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:28)
Show buried residues

Minimal score value
-3.7851
Maximal score value
3.3121
Average score
0.0961
Total score value
27.7815

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
10 H A -1.1490
11 P A -0.7375
12 T A 0.2333
13 L A 1.1737
14 G A 0.8177
15 V A 1.2339
16 Q A 0.0000
17 L A 1.8975
18 F A 2.5994
19 S A 0.0000
20 A A 0.0000
21 G A 2.0060
22 I A 2.3861
23 A A 0.0000
24 A A 0.0000
25 C A 1.7465
26 L A 2.0563
27 A A 0.0000
28 D A 0.0000
29 V A 1.8643
30 I A 1.9354
31 T A 1.1648
32 F A 0.0000
33 P A 0.4662
34 L A 0.9425
35 D A 0.0000
36 T A 0.0000
37 A A 0.0000
38 K A 0.1875
39 V A 0.0000
40 R A 0.0000
41 L A 0.0000
42 Q A 0.0000
43 V A -0.1502
44 Q A -0.6803
45 G A -0.5363
46 E A -0.7031
47 C A 0.2295
48 P A -0.3439
49 T A -0.0503
50 S A 0.1793
51 S A 0.5661
52 V A 1.6715
53 I A 0.5911
54 R A -1.2928
55 Y A -1.0355
56 K A -1.8678
57 G A -0.5708
58 V A 0.7010
59 L A 1.2509
60 G A -0.2289
61 T A 0.0000
62 I A 0.1829
63 T A -0.2542
64 A A -0.8109
65 V A 0.0000
66 V A -1.2795
67 K A -2.0533
68 T A -1.0893
69 E A -0.9654
70 G A -1.3996
71 R A -1.7283
72 M A 0.0688
73 K A -0.3870
74 L A 0.0971
75 Y A 0.5491
76 S A 0.0809
77 G A 0.0000
78 L A 0.3211
79 P A 0.0211
80 A A 0.0000
81 G A 0.0000
82 L A 0.8157
83 Q A -0.0038
84 R A 0.2048
85 Q A 0.0000
86 I A 2.2117
87 S A 0.9145
88 S A 0.0000
89 A A 0.3449
90 S A 1.2012
91 L A 1.2695
92 R A -0.1025
93 I A 0.0775
94 G A 0.0000
95 L A 0.5522
96 Y A 0.1221
97 D A -0.7829
98 T A 0.0693
99 V A 0.5453
100 Q A -0.2513
101 E A -1.5701
102 F A 0.9347
103 L A 0.3412
104 T A 0.0000
105 A A -0.8627
106 G A -1.8546
107 K A -2.8804
108 E A -2.9598
109 T A -1.5475
110 A A -0.8087
111 P A -0.9608
112 S A -0.1875
113 L A 0.3732
114 G A 0.1134
115 S A 0.2712
116 K A -0.1143
117 I A 0.8624
118 L A 1.5323
119 A A 0.0000
120 G A 0.0000
121 L A 1.3049
122 T A 0.9577
123 T A 0.0000
124 G A 0.0000
125 G A 1.5642
126 V A 2.3587
127 A A 0.0000
128 V A 0.0000
129 F A 3.3121
130 I A 3.2346
131 G A 1.6429
132 Q A 0.0000
133 P A 0.6190
134 T A 0.0000
135 E A 0.0000
136 V A 0.0000
137 V A 0.0000
138 K A -0.3149
139 V A 0.0000
140 R A -0.5920
141 L A 0.0000
142 Q A 0.0000
143 A A -0.2839
144 Q A -0.7698
145 S A -0.8268
146 H A -1.0674
147 L A 0.3391
148 H A -0.7220
149 G A -0.4417
150 I A 0.1581
151 K A -1.7092
152 P A -1.6456
153 R A -2.1617
154 Y A -1.0900
155 T A -0.3803
156 G A -0.1821
157 T A 0.1992
158 Y A 0.7355
159 N A -0.4381
160 A A 0.0000
161 Y A 0.0531
162 R A -1.4396
163 I A -0.7756
164 I A 0.0000
165 A A -0.6050
166 T A -0.6825
167 T A -0.9744
168 E A -1.7795
169 G A -0.4365
170 L A 1.1601
171 T A 0.3586
172 G A -0.2357
173 L A 0.0000
174 W A 1.1220
175 K A -0.1302
176 G A -0.0139
177 T A 0.7086
178 T A 0.3820
179 P A 0.0000
180 N A 0.0000
181 L A 1.2062
182 M A 0.9980
183 R A 0.6888
184 S A 0.7614
185 V A 1.5576
186 I A 1.3098
187 I A 0.7507
188 N A 0.3967
189 C A 0.7645
190 T A 0.0000
191 E A 0.0398
192 L A 0.3603
193 V A 0.9838
194 T A 0.7002
195 Y A 0.7159
196 D A -0.0858
197 L A 0.9122
198 M A 0.2831
199 K A -0.9931
200 E A -2.0420
201 A A -1.1334
202 F A -0.6746
203 V A -1.6885
204 K A -2.6429
205 N A -1.9138
206 N A -1.4136
207 I A 0.9856
208 L A 0.0974
209 A A -0.6647
210 D A -2.2763
211 D A -1.6440
212 V A 0.7179
213 P A 0.3499
214 C A 0.0000
215 H A 0.5528
216 L A 2.1281
217 V A 2.2143
218 S A 0.0000
219 A A 1.5267
220 L A 2.6723
221 I A 2.2663
222 A A 0.0000
223 G A 1.4313
224 F A 2.2521
225 C A 1.3576
226 A A 0.0000
227 T A 0.0000
228 A A 1.4462
229 M A 1.5507
230 S A 0.0000
231 S A 0.0000
232 P A 0.7624
233 V A 0.7011
234 D A 0.0000
235 V A 0.0000
236 V A 0.0000
237 K A 0.0000
238 T A 0.0000
239 R A 0.0000
240 F A -0.2540
241 I A 0.0000
242 N A -0.3839
243 S A 0.0000
244 P A -0.5858
245 P A -1.4246
246 G A -1.5337
247 Q A -1.8585
248 Y A -1.5485
249 K A -2.0973
250 S A -1.0003
251 V A -0.1804
252 P A -0.3466
253 N A -0.4525
254 C A 0.0000
255 A A 0.6812
256 M A 0.9216
257 K A -0.4241
258 V A 0.0000
259 F A 1.1480
260 T A -0.1433
261 N A -1.4131
262 E A -1.3559
263 G A -0.2178
264 P A 0.2566
265 T A 0.3702
266 A A 0.3215
267 F A 1.1361
268 F A 1.8598
269 K A 0.6816
270 G A 0.5844
271 L A 1.7666
272 V A 2.2601
273 P A 0.0000
274 S A 0.0000
275 F A 1.7134
276 L A 1.4659
277 R A 0.8566
278 L A 0.9036
279 G A 1.0673
280 S A 1.1628
281 W A 1.4344
282 N A 1.5855
283 V A 2.9808
284 I A 2.7931
285 M A 0.0000
286 F A 3.0652
287 V A 2.7143
288 C A 1.3913
289 F A 0.8217
290 E A -1.4133
291 Q A -1.9495
292 L A -1.2142
293 K A -2.2223
294 R A -3.7851
295 E A -3.3100
296 L A -1.2518
297 S A -1.9512
298 K A -2.4032
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.3917 6.0988 View CSV PDB
4.5 0.3581 6.0988 View CSV PDB
5.0 0.3178 6.0988 View CSV PDB
5.5 0.2813 6.0988 View CSV PDB
6.0 0.2584 6.0988 View CSV PDB
6.5 0.2548 6.0988 View CSV PDB
7.0 0.2698 6.0988 View CSV PDB
7.5 0.2975 6.0988 View CSV PDB
8.0 0.3319 6.0988 View CSV PDB
8.5 0.3703 6.0988 View CSV PDB
9.0 0.4121 6.0988 View CSV PDB