Project name: AAVA_R2

Status: done

Started: 2026-08-21 04:28:06
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:43)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/762ff88449bfdbc/tmp/folded.pdb                (00:01:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:59)
Show buried residues

Minimal score value
-2.5151
Maximal score value
1.9377
Average score
-0.5257
Total score value
-130.3736

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4994
2 V A -1.0309
3 Q A -1.5590
4 L A 0.0000
5 Q A -1.7680
6 E A 0.0000
7 S A -0.6926
8 G A -0.3734
9 P A 0.0420
10 G A 0.3815
11 L A 0.9709
12 V A 0.0000
13 K A -1.8464
14 P A -1.3473
15 S A -1.4464
16 Q A -2.0185
17 T A -1.6409
18 L A 0.0000
19 S A -0.9849
20 L A 0.0000
21 T A -0.6957
22 A A 0.0000
23 T A -1.1965
24 V A 0.0000
25 S A -1.1999
26 G A -1.2461
27 G A -0.9663
28 S A -0.7135
29 I A 0.0000
30 S A -0.2545
31 S A -0.2885
32 G A -0.0537
33 D A 0.0561
34 Y A 0.6662
35 Y A 0.6243
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6883
43 P A -0.6469
44 G A -1.1112
45 C A -1.2260
46 K A -2.0303
47 G A -1.2551
48 L A 0.0000
49 E A -0.7517
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1423
54 I A 0.0000
55 Y A 0.3126
56 Y A 0.3216
57 S A -0.0572
58 G A -0.3257
59 S A -0.2983
60 T A -0.2781
61 D A -0.7274
62 Y A -0.7132
63 N A -0.9237
64 P A -1.1528
65 S A -1.0019
66 L A 0.0000
67 K A -2.0898
68 S A -1.4059
69 R A -1.6446
70 V A 0.0000
71 T A -1.1001
72 M A 0.0000
73 S A -0.4273
74 V A -0.4342
75 D A -1.2902
76 T A -1.0620
77 S A -1.3771
78 K A -2.2070
79 N A -1.4729
80 Q A -1.3037
81 F A 0.0000
82 S A -0.5742
83 L A 0.0000
84 K A -1.6086
85 V A 0.0000
86 N A -1.7708
87 S A -1.5570
88 V A 0.0000
89 T A -0.6841
90 A A -0.3011
91 A A -0.0836
92 D A 0.0000
93 T A 0.2941
94 A A 0.0000
95 V A 0.2395
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7436
103 I A 1.4793
104 F A 1.9377
105 G A 0.6671
106 V A 0.6286
107 G A 0.4915
108 T A 0.0000
109 F A 0.0000
110 D A -0.5251
111 Y A -0.3402
112 W A -0.6833
113 G A 0.0000
114 Q A -1.5739
115 G A -0.7480
116 T A -0.1844
117 L A 0.8522
118 V A 0.0000
119 T A 0.3551
120 V A 0.0000
121 S A -0.3842
122 S A -0.6389
123 A A -0.6212
124 A A -0.3548
125 G A -0.8355
126 G A -1.0694
127 G A -1.1178
128 G A -1.1533
129 S A -1.0225
130 G A -1.1398
131 G A -1.2257
132 G A -1.1816
133 G A -1.2336
134 S A -1.0376
135 G A -1.2201
136 G A -1.3192
137 G A -1.2623
138 G A -1.2671
139 S A -0.9428
140 D A -0.9698
141 I A -0.1462
142 V A 0.9774
143 M A 0.0000
144 T A -0.5790
145 Q A -0.6735
146 S A -0.7509
147 P A -0.3372
148 A A -0.3414
149 T A -0.4337
150 L A -0.1815
151 S A -0.3152
152 L A -0.5541
153 S A -0.8444
154 P A -1.3507
155 G A -1.6385
156 E A -2.0591
157 R A -2.5151
158 A A 0.0000
159 T A -0.6331
160 L A 0.0000
161 S A -0.8850
162 V A 0.0000
163 R A -2.2896
164 A A 0.0000
165 S A -0.8659
166 Q A -1.5794
167 S A -1.2007
168 V A 0.0000
169 S A -0.4258
170 S A -0.1183
171 Y A 0.8219
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5620
179 P A -0.9449
180 G A -0.9914
181 C A -1.1407
182 Q A -1.5790
183 A A -1.1782
184 P A 0.0000
185 R A -1.5466
186 L A -0.6712
187 L A 0.0000
188 I A 0.0000
189 Y A -0.1912
190 D A -0.3598
191 A A 0.0000
192 S A -0.8568
193 N A -1.2248
194 R A -1.2886
195 A A -0.8890
196 T A -0.5632
197 G A -0.6389
198 I A 0.0000
199 P A -0.4081
200 A A -0.3480
201 R A -0.6849
202 F A 0.0000
203 S A -0.6346
204 G A -0.6703
205 S A -0.7887
206 G A -1.0887
207 S A -0.7142
208 G A -1.0215
209 T A -1.7164
210 D A -2.0847
211 F A 0.0000
212 T A -0.7602
213 L A 0.0000
214 T A -0.5896
215 I A 0.0000
216 S A -1.2712
217 S A -1.6031
218 L A 0.0000
219 E A -2.1312
220 P A -1.3806
221 E A -2.1164
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.6248
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A 0.0066
233 S A -0.2634
234 T A -0.4509
235 P A -0.5591
236 L A 0.0000
237 T A 0.1084
238 F A 0.2379
239 G A 0.0000
240 G A -0.8126
241 G A -0.7691
242 T A 0.0000
243 K A -0.8034
244 A A 0.0000
245 E A -0.3868
246 I A 0.7696
247 K A -0.7376
248 A A -0.2804
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4995 4.8749 View CSV PDB
4.5 -0.5187 4.8682 View CSV PDB
5.0 -0.5405 4.852 View CSV PDB
5.5 -0.5599 4.8219 View CSV PDB
6.0 -0.5709 4.7799 View CSV PDB
6.5 -0.5692 4.7318 View CSV PDB
7.0 -0.5555 4.6813 View CSV PDB
7.5 -0.534 4.63 View CSV PDB
8.0 -0.5082 4.5785 View CSV PDB
8.5 -0.479 4.5271 View CSV PDB
9.0 -0.4471 4.4765 View CSV PDB