Project name: HS_195

Status: done

Started: 2026-03-20 01:17:28
Chain sequence(s) A: EVQLQQSGPEVVKPGASVRMSCKASGYTFTDYFMDWVKLSHGEGFEWIGRVNPYNGGTSYNQKFKDKATLTVDKSSSTAYMELKSLTSEDSAVYYCARGDGFYYAMDYWGQGTSVTVSS
B: DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGQPPKLLIYAASNQGSGVPARFSGSGSGTDFSLNIHPMEEDDTAMYFCQQSKEVPRTFGGGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       CABS:     Running CABS flex simulation                                                (00:04:08)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:48:08)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:48:09)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:48:11)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:48:12)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:48:13)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:48:14)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:48:15)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:48:16)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:48:18)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:48:19)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:48:20)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:48:21)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:48:22)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:48:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:48:29)
Show buried residues

Minimal score value
-3.1534
Maximal score value
1.4058
Average score
-0.5988
Total score value
-138.3281

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8948
2 V A -1.3954
3 Q A -1.9931
4 L A 0.0000
5 Q A -2.0418
6 Q A 0.0000
7 S A -0.9374
8 G A -0.8035
9 P A -0.5006
10 E A -0.3767
11 V A 0.7898
12 V A 0.0000
13 K A -1.6465
14 P A -1.3935
15 G A -1.2553
16 A A -1.3715
17 S A -1.5916
18 V A 0.0000
19 R A -2.2080
20 M A 0.0000
21 S A -0.5965
22 C A 0.0000
23 K A -1.2720
24 A A 0.0000
25 S A -1.0729
26 G A -0.7862
27 Y A 0.0066
28 T A -0.2997
29 F A 0.0000
30 T A -0.9531
31 D A -1.7412
32 Y A -0.5317
33 F A 0.0028
34 M A 0.0000
35 D A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A 0.0000
39 L A 0.0000
40 S A -1.2497
41 H A -1.9477
42 G A -1.5501
43 E A -1.7651
44 G A -1.1228
45 F A 0.0000
46 E A 0.0000
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 R A 0.0000
51 V A 0.0000
52 N A -0.8592
53 P A -1.3725
54 Y A 0.0000
55 N A -2.2488
56 G A -1.4190
57 G A -0.8640
58 T A -0.2124
59 S A 0.2388
60 Y A 0.5403
61 N A 0.0000
62 Q A -1.4326
63 K A -1.5480
64 F A 0.0000
65 K A -2.2205
66 D A 0.0000
67 K A -2.0658
68 A A -1.4148
69 T A -0.8732
70 L A 0.0000
71 T A -0.2657
72 V A -1.0777
73 D A -2.2716
74 K A -2.6760
75 S A -1.5464
76 S A -1.0963
77 S A 0.0000
78 T A 0.0000
79 A A 0.0000
80 Y A -0.0441
81 M A 0.0000
82 E A -1.9116
83 L A 0.0000
84 K A -2.6107
85 S A -1.6216
86 L A -1.3551
87 T A -1.5091
88 S A -1.3544
89 E A -2.0556
90 D A 0.0000
91 S A -0.8338
92 A A 0.0000
93 V A -0.3158
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A 0.0000
100 D A 0.0000
101 G A -0.2778
102 F A 0.7424
103 Y A 1.3109
104 Y A 0.7232
105 A A 0.0000
106 M A 0.0000
107 D A 0.0000
108 Y A -0.5393
109 W A 0.0000
110 G A -1.2519
111 Q A -1.5831
112 G A -0.8923
113 T A 0.0000
114 S A -0.1824
115 V A 0.0000
116 T A -0.0344
117 V A -0.4750
118 S A -0.5085
119 S A -0.7948
1 D B -0.5940
2 I B 1.4058
3 V B 1.0975
4 L B 0.0000
5 T B -0.5598
6 Q B -0.6980
7 S B -0.6831
8 P B 0.0000
9 A B -0.1952
10 S B -0.3558
11 L B -0.4740
12 A B -1.2608
13 V B 0.0000
14 S B -1.1256
15 L B 0.2166
16 G B -0.6338
17 Q B -1.6483
18 R B -1.5305
19 A B 0.0000
20 T B -0.6045
21 I B 0.0000
22 S B -0.9287
23 C B 0.0000
24 R B -2.2117
25 A B 0.0000
26 S B -0.3866
27 E B -0.0695
28 S B -0.1585
29 V B 0.0999
30 D B 0.0000
31 N B -0.3483
32 Y B 0.9034
33 G B 0.5978
34 I B 1.3210
35 S B 0.6728
36 F B 0.8729
37 M B 0.2205
38 N B 0.0000
39 W B 0.0000
40 F B 0.0000
41 Q B 0.0000
42 Q B 0.0000
43 K B -2.1996
44 P B -1.4476
45 G B -1.2438
46 Q B -1.3622
47 P B -0.9287
48 P B 0.0000
49 K B -0.6754
50 L B 0.0000
51 L B 0.0000
52 I B 0.0000
53 Y B 0.0000
54 A B 0.0000
55 A B 0.0386
56 S B -1.0615
57 N B -2.0129
58 Q B -2.0792
59 G B -1.1500
60 S B -0.9564
61 G B -0.9575
62 V B -0.5376
63 P B -0.6835
64 A B -0.9614
65 R B -1.3111
66 F B -0.9075
67 S B -0.9324
68 G B -0.9584
69 S B -0.8393
70 G B -0.7738
71 S B -0.7839
72 G B -0.8446
73 T B -1.3740
74 D B -1.8008
75 F B 0.0000
76 S B -0.8713
77 L B 0.0000
78 N B -0.7842
79 I B 0.0000
80 H B -1.0453
81 P B 0.0000
82 M B -1.4207
83 E B -3.0831
84 E B -3.1534
85 D B 0.0000
86 D B -3.0425
87 T B -2.0550
88 A B 0.0000
89 M B -0.9861
90 Y B 0.0000
91 F B 0.0000
92 C B 0.0000
93 Q B 0.0000
94 Q B 0.0000
95 S B 0.0000
96 K B -0.5482
97 E B -0.7105
98 V B 0.7070
99 P B 0.0000
100 R B 0.0000
101 T B 0.0000
102 F B 0.6906
103 G B 0.1262
104 G B 0.0000
105 G B -0.5606
106 T B 0.0000
107 K B -0.8287
108 L B 0.0000
109 E B -1.9894
110 I B -2.1106
111 K B -2.7395
112 R B -2.5604
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5988 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_9 -0.5988 View CSV PDB
model_8 -0.6312 View CSV PDB
model_1 -0.6724 View CSV PDB
model_10 -0.6852 View CSV PDB
model_7 -0.7075 View CSV PDB
CABS_average -0.7121 View CSV PDB
model_2 -0.7133 View CSV PDB
model_4 -0.7215 View CSV PDB
input -0.7365 View CSV PDB
model_0 -0.753 View CSV PDB
model_3 -0.7532 View CSV PDB
model_6 -0.7569 View CSV PDB
model_11 -0.7629 View CSV PDB
model_5 -0.7895 View CSV PDB