Project name: 77ff553673073fa

Status: done

Started: 2026-03-10 19:02:28
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTGGSSGGDDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:47)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/77ff553673073fa/tmp/folded.pdb                (00:04:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:42)
Show buried residues

Minimal score value
-5.3491
Maximal score value
3.1504
Average score
-0.942
Total score value
-303.3226

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1637
2 H A -1.3797
3 H A -2.0990
4 H A -2.5446
5 H A -2.6611
6 H A -2.6183
7 H A -2.3211
8 F A -1.7899
9 D A -2.6713
10 A A -1.9710
11 S A -2.1341
12 N A -2.3692
13 F A 0.0000
14 K A -2.1006
15 D A -1.1357
16 F A -0.3489
17 S A -0.5987
18 S A -1.0281
19 I A 0.0000
20 A A -0.4967
21 S A -0.9372
22 A A -1.0155
23 S A -0.6864
24 S A 0.0000
25 S A -0.0100
26 W A 0.0000
27 Q A -0.8121
28 N A 0.0000
29 Q A -1.7723
30 S A -1.3959
31 G A -1.2171
32 S A 0.0000
33 T A -0.6930
34 M A 0.0000
35 I A 0.0339
36 I A 0.0000
37 Q A -1.5996
38 V A 0.0000
39 D A -0.9581
40 S A 0.2475
41 F A 1.0751
42 G A 0.0000
43 N A -1.1589
44 V A 0.0000
45 S A -1.1949
46 G A -0.7597
47 Q A -0.7855
48 Y A 0.0000
49 V A 0.0000
50 N A 0.0000
51 R A -2.6321
52 A A -1.9870
53 Q A -1.9965
54 G A -1.4693
55 T A -1.2906
56 G A -1.7350
57 C A 0.0000
58 Q A -2.7846
59 N A -2.3135
60 S A -1.5865
61 P A -1.1658
62 Y A 0.0000
63 P A -0.8300
64 L A 0.0000
65 T A -0.9769
66 G A -1.3240
67 R A -1.9349
68 V A 0.0000
69 N A -0.9947
70 G A -0.5368
71 T A 0.0791
72 F A 1.0674
73 I A 0.0000
74 A A -0.4333
75 F A 0.0000
76 S A -0.6066
77 V A 0.0000
78 G A -1.1543
79 W A 0.0000
80 N A -2.6323
81 N A -1.7209
82 S A -1.1819
83 T A -1.5237
84 E A -2.5465
85 N A -2.7955
86 C A -1.8595
87 N A -2.2481
88 S A -1.2680
89 A A -0.2833
90 T A 0.0000
91 G A -0.5024
92 W A 0.0000
93 T A -0.0305
94 G A 0.0000
95 Y A 1.1603
96 A A 0.0000
97 Q A -0.4161
98 V A -0.9586
99 N A -1.6473
100 G A -1.6193
101 N A -2.2082
102 N A -1.6162
103 T A 0.0000
104 E A 0.0000
105 I A 0.0000
106 V A 0.2945
107 T A 0.0000
108 S A -0.8772
109 W A -1.0863
110 N A -0.8227
111 L A -0.0125
112 A A -0.0603
113 Y A -0.5705
114 E A -1.9257
115 G A -1.1281
116 G A -1.1066
117 S A -0.9310
118 G A -1.0832
119 P A -0.8162
120 A A -0.0295
121 I A 0.9762
122 E A -0.6130
123 Q A -1.6364
124 G A -1.6261
125 Q A -1.7581
126 D A -1.1515
127 T A -0.6912
128 F A 0.0000
129 Q A -0.6369
130 Y A 0.0782
131 V A 0.5110
132 P A -0.4898
133 T A -0.7823
134 T A -1.5205
135 E A -3.0446
136 N A -2.7540
137 K A -2.4232
138 S A -1.0031
139 L A 0.9009
140 L A 0.7090
141 K A -1.5532
142 D A -2.2816
143 T A -1.5741
144 G A -1.5263
145 G A -1.1559
146 S A -0.8182
147 S A -0.8864
148 G A -1.2857
149 G A -1.7587
150 D A -2.1975
151 D A -3.1032
152 R A -2.5854
153 F A -0.5459
154 N A -2.0587
155 D A -1.7078
156 V A 0.4943
157 N A -0.6029
158 T A -0.3659
159 I A 0.4779
160 N A -1.8092
161 K A -2.7216
162 K A -2.8014
163 Q A -1.9843
164 F A -0.0741
165 T A -1.3297
166 E A -2.3623
167 E A -2.5010
168 E A -1.9124
169 F A -0.1605
170 S A -1.1515
171 R A -2.1188
172 L A -0.3028
173 I A 0.4644
174 N A -1.1405
175 S A -0.6885
176 M A -0.0904
177 L A -0.0090
178 K A -2.0119
179 E A -2.7297
180 Y A -0.8060
181 I A -1.2365
182 E A -4.0945
183 D A -4.6557
184 N A -4.4408
185 K A -5.1323
186 K A -5.3491
187 D A -5.1931
188 K A -4.6134
189 H A -3.1504
190 P A -1.9628
191 T A -1.7704
192 Q A -2.2830
193 K A -2.4335
194 T A -1.5067
195 T A -1.2917
196 P A -1.4190
197 K A -1.9980
198 P A -1.2386
199 T A -0.9245
200 T A -1.0323
201 P A -1.2436
202 K A -2.0579
203 Q A -1.6472
204 I A -0.1479
205 N A -1.7612
206 D A -2.2995
207 G A -1.7021
208 T A -1.4051
209 S A -1.6377
210 D A -2.8397
211 K A -2.9265
212 T A -1.9636
213 S A -1.8840
214 D A -2.4242
215 T A -1.2936
216 H A -1.2681
217 T A -0.4825
218 I A 0.3792
219 K A -1.7893
220 R A -2.2415
221 T A -1.4837
222 T A -1.3530
223 P A -1.4183
224 K A -1.9995
225 P A -1.2347
226 T A -0.9463
227 T A -1.0080
228 P A -1.2414
229 K A -2.0645
230 Q A -1.6405
231 I A -0.1497
232 N A -1.7458
233 D A -2.2886
234 G A -1.6997
235 T A -1.4506
236 S A -1.6341
237 D A -2.8348
238 K A -2.9321
239 T A -2.0364
240 S A -1.8604
241 D A -2.4295
242 T A -1.2790
243 H A -1.2558
244 T A -0.5144
245 I A 0.3504
246 K A -1.7903
247 R A -2.2201
248 T A -1.4971
249 T A -1.3669
250 P A -1.4279
251 K A -2.0002
252 P A -1.2380
253 T A -0.9678
254 T A -1.0657
255 P A -1.2178
256 K A -2.0354
257 Q A -1.6805
258 I A -0.2435
259 N A -1.8115
260 D A -2.3146
261 G A -1.7599
262 T A -1.8858
263 S A -1.9561
264 D A -3.1000
265 K A -3.1054
266 P A -1.2976
267 K A -2.0829
268 S A -0.0700
269 I A 2.0986
270 A A 1.6740
271 D A 1.0314
272 I A 1.8466
273 F A 2.0514
274 L A 2.3794
275 I A 2.0184
276 N A -0.5567
277 K A -1.6856
278 P A -1.3804
279 K A -1.9735
280 V A 0.0537
281 P A 0.8727
282 L A 2.0491
283 W A 2.1961
284 I A 2.0633
285 V A 1.6502
286 N A 0.8875
287 P A 1.4220
288 L A 2.2543
289 Y A 1.5936
290 Y A 1.8010
291 M A 2.0756
292 V A 1.6550
293 E A 0.2454
294 K A 0.9111
295 F A 2.8364
296 V A 2.5099
297 Q A 1.5997
298 I A 3.1504
299 M A 2.7356
300 G A 2.2052
301 Y A 2.7514
302 L A 2.6696
303 L A 1.0837
304 E A -1.8212
305 D A -3.3126
306 D A -3.6863
307 D A -3.3804
308 T A -1.5154
309 L A -0.0346
310 E A -0.7602
311 L A 0.6983
312 N A -0.5507
313 L A 0.5069
314 P A 0.3166
315 K A -0.4653
316 Y A 1.3243
317 Y A 1.5299
318 Y A 0.5513
319 D A -1.2188
320 K A -1.5600
321 S A -0.4428
322 I A 1.0050
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4557 5.6211 View CSV PDB
4.5 -0.544 5.6211 View CSV PDB
5.0 -0.647 5.6211 View CSV PDB
5.5 -0.7403 5.6211 View CSV PDB
6.0 -0.7988 5.6211 View CSV PDB
6.5 -0.8113 5.6211 View CSV PDB
7.0 -0.7873 5.6211 View CSV PDB
7.5 -0.7435 5.6211 View CSV PDB
8.0 -0.6887 5.6211 View CSV PDB
8.5 -0.6228 5.6211 View CSV PDB
9.0 -0.5438 5.6211 View CSV PDB