Project name: AlaVal_R3

Status: done

Started: 2026-08-20 09:25:16
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYVARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:02)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7a16e6deec2fb10/tmp/folded.pdb                (00:02:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:33)
Show buried residues

Minimal score value
-2.7032
Maximal score value
1.9458
Average score
-0.5405
Total score value
-134.0534

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4729
2 V A -0.9776
3 Q A -1.4573
4 L A 0.0000
5 Q A -1.6432
6 E A 0.0000
7 S A -0.6227
8 G A -0.2993
9 P A 0.0169
10 G A 0.5620
11 L A 0.9901
12 V A 0.0000
13 K A -1.8432
14 P A -1.5103
15 S A -1.4691
16 Q A -2.0332
17 T A -1.6767
18 L A 0.0000
19 S A -0.8754
20 L A 0.0000
21 T A -0.5507
22 A A 0.0000
23 T A -1.1205
24 V A 0.0000
25 S A -1.1862
26 G A -1.2322
27 G A -0.9623
28 S A -0.7186
29 I A 0.0000
30 S A -0.2589
31 S A -0.2920
32 G A -0.0723
33 D A -0.0728
34 Y A 0.5262
35 Y A 0.5998
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.4240
41 Q A 0.0000
42 P A -0.7364
43 P A -0.6849
44 G A -1.1263
45 C A -1.2349
46 K A -2.0639
47 G A -1.2945
48 L A 0.0000
49 E A -0.8469
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1445
54 I A 0.0000
55 Y A 0.3945
56 Y A 0.3394
57 S A -0.1002
58 G A -0.2150
59 S A -0.2478
60 T A -0.2051
61 D A -0.6907
62 Y A -0.6880
63 N A -0.9072
64 P A -1.1222
65 S A -0.9175
66 L A 0.0000
67 K A -2.1108
68 S A -1.5026
69 R A -1.7911
70 V A 0.0000
71 T A -1.0468
72 M A 0.0000
73 S A -0.3256
74 V A -0.3519
75 D A -1.1814
76 T A -1.0347
77 S A -1.3387
78 K A -2.1669
79 N A -1.4385
80 Q A -1.2475
81 F A 0.0000
82 S A -0.4237
83 L A 0.0000
84 K A -1.2747
85 V A 0.0000
86 N A -2.0501
87 S A -1.6441
88 V A 0.0000
89 T A -0.7055
90 A A -0.2952
91 A A -0.0351
92 D A 0.0000
93 T A 0.2936
94 A A 0.0000
95 V A 0.2278
96 Y A 0.0000
97 Y A 0.0000
98 V A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.6488
103 I A 1.4107
104 F A 1.9458
105 G A 0.7207
106 V A 0.6212
107 G A 0.6276
108 T A 0.0000
109 F A 0.0000
110 D A -0.5996
111 Y A -0.1656
112 W A -0.6332
113 G A 0.0000
114 Q A -1.5922
115 G A -0.7414
116 T A -0.1317
117 L A 0.9230
118 V A 0.0000
119 T A 0.3900
120 V A 0.0000
121 S A -0.4068
122 S A -0.6477
123 A A -0.6451
124 A A -0.3562
125 G A -0.8396
126 G A -1.0750
127 G A -1.1247
128 G A -1.1742
129 S A -1.0295
130 G A -1.1590
131 G A -1.2202
132 G A -1.1935
133 G A -1.2191
134 S A -1.0490
135 G A -1.2259
136 G A -1.2782
137 G A -1.2228
138 G A -1.2632
139 S A -0.9531
140 D A -1.0055
141 I A 0.0000
142 V A 0.9333
143 M A 0.0000
144 T A -0.6043
145 Q A -0.8260
146 S A -0.7041
147 P A -0.3330
148 A A -0.3439
149 T A -0.4491
150 L A -0.1791
151 S A -0.3278
152 L A -0.6540
153 S A -0.9815
154 P A -1.4646
155 G A -1.8122
156 E A -2.4396
157 R A -2.7032
158 A A 0.0000
159 T A -0.6648
160 L A 0.0000
161 S A -0.8738
162 A A 0.0000
163 R A -2.3687
164 A A 0.0000
165 S A -0.9280
166 Q A -1.6330
167 S A -1.2386
168 V A 0.0000
169 S A -0.4319
170 S A -0.2739
171 Y A 0.8172
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3802
179 P A -1.0495
180 G A -0.9771
181 C A -1.1370
182 Q A -1.5653
183 A A -1.1381
184 P A 0.0000
185 R A -1.4430
186 L A -0.7185
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5357
190 D A -0.6892
191 A A 0.0000
192 S A -1.2483
193 N A -1.9001
194 R A -1.6760
195 A A -1.0867
196 T A -0.6403
197 G A -0.6298
198 I A 0.0000
199 P A -0.4283
200 A A -0.3628
201 R A -0.7097
202 F A 0.0000
203 S A -0.7564
204 G A 0.0000
205 S A -0.8975
206 G A -1.1460
207 S A -0.9600
208 G A -1.0501
209 T A -1.7716
210 D A -2.2042
211 F A 0.0000
212 T A -0.7782
213 L A 0.0000
214 T A -0.5849
215 I A 0.0000
216 S A -1.3538
217 S A -1.7357
218 L A 0.0000
219 E A -2.1638
220 P A -1.3868
221 E A -2.2088
222 D A 0.0000
223 F A -0.6499
224 A A 0.0000
225 V A -0.6183
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3199
232 G A 0.0467
233 S A -0.2117
234 T A -0.4173
235 P A -0.4298
236 L A 0.0000
237 T A 0.1464
238 F A 0.2248
239 G A 0.0000
240 G A -0.8356
241 G A -0.7939
242 T A 0.0000
243 K A -0.7567
244 A A 0.0000
245 E A -0.3983
246 I A 0.7320
247 K A -0.8788
248 A A -0.3477
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4857 4.7892 View CSV PDB
4.5 -0.5084 4.7562 View CSV PDB
5.0 -0.5348 4.7136 View CSV PDB
5.5 -0.5589 4.6666 View CSV PDB
6.0 -0.574 4.6179 View CSV PDB
6.5 -0.5758 4.5688 View CSV PDB
7.0 -0.5646 4.5196 View CSV PDB
7.5 -0.545 4.4706 View CSV PDB
8.0 -0.5208 4.4226 View CSV PDB
8.5 -0.4931 4.3773 View CSV PDB
9.0 -0.462 4.339 View CSV PDB