Project name: f376d2ac5c02159 [mutate: IK46A, LT150A, IR183A]

Status: done

Started: 2026-04-11 13:08:11
Chain sequence(s) A: ARKVTQSPTEISVPEGADVTLDCYYETRDTTYYLFWYKQDPGEGLIFLIRRNSFDEQNEKRGRYIWIFNPSKKSFNLTITNVRPEDSAVYFCALTKGNSGYALNFGKGTKLTVTPGGGSEGGGSEGGGSEGGGSEGGTGEVKVTQSPRYLVKPEGAKVTLECVQDMDHENMFWYRQDPGKGLILIYFSYDVKMIEKGDIPEGYSVSRPSKERFSLIIPSAQPDQTSLYLCASSFSYGAYEQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues IK46A,LT150A,IR183A
Energy difference between WT (input) and mutated protein (by FoldX) 3.68791 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:35)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7a60c08ab7f43e3/tmp/folded.pdb                (00:02:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:36)
Show buried residues

Minimal score value
-3.2855
Maximal score value
1.415
Average score
-0.9066
Total score value
-228.454

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A A -1.3720
2 R A -2.4607
3 K A -2.3483
4 V A -1.4045
5 T A -0.8495
6 Q A 0.0000
7 S A -0.8636
8 P A -0.9251
9 T A -1.6067
10 E A -2.1125
11 I A -0.8192
12 S A -0.6401
13 V A -0.6623
14 P A -1.4965
15 E A -2.3243
16 G A -1.7852
17 A A -1.7004
18 D A -2.3341
19 V A 0.0000
20 T A -0.3952
21 L A 0.0000
22 D A -0.3183
23 C A 0.0000
24 Y A -0.8710
25 Y A 0.0000
26 E A -3.0289
27 T A -2.6072
28 R A -2.5474
29 D A -1.7867
30 T A -0.6205
31 T A -0.4272
32 Y A -0.4219
33 Y A -0.0626
34 L A 0.0000
35 F A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 K A -1.1073
39 Q A 0.0000
40 D A -1.9488
41 P A -1.1548
42 G A -1.6052
43 E A -1.9832
44 G A -1.0437
45 L A 0.0000
46 K A -1.7188 mutated: IK46A
47 F A -0.4812
48 L A 0.0000
49 I A 0.0000
50 R A -0.5996
51 R A 0.0000
52 N A -0.4414
53 S A 0.0055
54 F A 0.9491
55 D A -1.1874
56 E A -2.6711
57 Q A -2.9703
58 N A -2.8347
59 E A -2.8247
60 K A -3.2855
61 R A -3.0523
62 G A -1.8906
63 R A -1.6785
64 Y A -1.3567
65 I A -1.2555
66 W A 0.0000
67 I A -0.8349
68 F A 0.0000
69 N A -2.2630
70 P A -1.4805
71 S A -1.5751
72 K A -2.4121
73 K A -2.2527
74 S A 0.0000
75 F A 0.0000
76 N A -0.3083
77 L A 0.0000
78 T A -0.5467
79 I A 0.0000
80 T A -1.4664
81 N A -1.8438
82 V A 0.0000
83 R A -2.3095
84 P A -1.9058
85 E A -2.3267
86 D A 0.0000
87 S A -1.2148
88 A A 0.0000
89 V A -0.9934
90 Y A 0.0000
91 F A 0.0000
92 C A 0.0000
93 A A 0.0000
94 L A 0.0000
95 T A 0.0000
96 K A -1.2763
97 G A -0.8785
98 N A -1.4263
99 S A -0.6731
100 G A 0.0000
101 Y A 0.4259
102 A A -0.3245
103 L A 0.0000
104 N A -1.0959
105 F A -1.0111
106 G A 0.0000
107 K A -2.2281
108 G A 0.0000
109 T A 0.0000
110 K A -1.8985
111 L A 0.0000
112 T A -1.0465
113 V A 0.0000
114 T A -0.8994
115 P A -1.1847
116 G A -1.4650
117 G A -1.4172
118 G A -1.4369
119 S A -1.6584
120 E A -2.4859
121 G A -1.8038
122 G A -1.3958
123 G A -1.5537
124 S A -1.5906
125 E A -2.3595
126 G A -1.7549
127 G A -1.5501
128 G A -1.3389
129 S A -1.6200
130 E A -2.4569
131 G A -1.7797
132 G A -1.6004
133 G A -1.6515
134 S A -1.7264
135 E A -2.4763
136 G A -1.7817
137 G A -1.6940
138 T A -1.2086
139 G A -1.2790
140 E A -1.8635
141 V A -0.5460
142 K A -1.3443
143 V A 0.0000
144 T A -0.5123
145 Q A 0.0000
146 S A -0.6633
147 P A -0.7318
148 R A -1.2373
149 Y A 0.2861
150 T A 0.0000 mutated: LT150A
151 V A 0.5937
152 K A -1.0774
153 P A -1.7153
154 E A -2.9512
155 G A -2.2093
156 A A -1.9259
157 K A -2.2895
158 V A 0.0000
159 T A -0.4247
160 L A 0.0000
161 E A -0.6174
162 C A 0.0000
163 V A -0.8713
164 Q A 0.0000
165 D A -2.7988
166 M A -1.6559
167 D A -2.4310
168 H A 0.0000
169 E A -0.7833
170 N A 0.0000
171 M A 0.0000
172 F A 0.0000
173 W A 0.0000
174 Y A 0.0000
175 R A -0.9979
176 Q A -1.4600
177 D A -1.3432
178 P A -0.9749
179 G A -1.6025
180 K A -2.1927
181 G A 0.0000
182 L A 0.0000
183 R A -1.9139 mutated: IR183A
184 L A 0.0000
185 I A 0.0000
186 Y A 0.0000
187 F A 0.0000
188 S A 0.0000
189 Y A 0.2073
190 D A -0.6856
191 V A -0.8646
192 K A -1.2561
193 M A 0.0199
194 I A -0.1655
195 E A -1.4681
196 K A -2.6142
197 G A -2.2239
198 D A -2.5033
199 I A -1.5608
200 P A 0.0000
201 E A -2.3552
202 G A -1.3904
203 Y A 0.0000
204 S A -0.4210
205 V A -0.2033
206 S A -0.2595
207 R A 0.0000
208 P A -1.0968
209 S A -1.3966
210 K A -2.4101
211 E A -2.9054
212 R A -1.7725
213 F A 0.0000
214 S A 0.0000
215 L A 0.0000
216 I A -0.1278
217 I A 0.0000
218 P A -1.0350
219 S A -1.6563
220 A A 0.0000
221 Q A -2.5025
222 P A -2.0689
223 D A -2.3521
224 Q A 0.0000
225 T A -1.1807
226 S A 0.0000
227 L A 0.0000
228 Y A 0.0000
229 L A 0.0000
230 C A 0.0000
231 A A 0.0000
232 S A 0.0000
233 S A 0.0000
234 F A 1.4150
235 S A 1.0663
236 Y A 1.3014
237 G A 0.3149
238 A A 0.5758
239 Y A 0.6067
240 E A 0.0000
241 Q A 0.0000
242 Y A 0.5203
243 F A -0.1813
244 G A 0.0000
245 P A -1.1934
246 G A 0.0000
247 T A 0.0000
248 R A -1.6914
249 L A 0.0000
250 T A -0.5679
251 V A 0.0000
252 T A -0.8521
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.613 3.7936 View CSV PDB
4.5 -0.6861 3.6694 View CSV PDB
5.0 -0.7748 3.5095 View CSV PDB
5.5 -0.8637 3.33 View CSV PDB
6.0 -0.9349 3.1496 View CSV PDB
6.5 -0.9737 2.987 View CSV PDB
7.0 -0.9775 2.8592 View CSV PDB
7.5 -0.9563 2.7774 View CSV PDB
8.0 -0.9211 2.7095 View CSV PDB
8.5 -0.8762 2.675 View CSV PDB
9.0 -0.8223 2.6594 View CSV PDB