Project name: HS_224

Status: done

Started: 2026-03-20 01:19:14
Chain sequence(s) A: EVQLVESGGGLVQPGGSLKLSCAASGFTFSNFGVSWVRQTPDKRLEFVATTNSYGDSSYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTREAYGNFFAYWGQGTLVTVSA
B: DVLMTQTPLSLSVSLGDQASISCRSSQSVVNRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:50)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:47:42)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:47:43)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:47:44)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:47:45)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:47:47)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:47:48)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:47:49)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:47:51)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:47:52)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:47:53)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:47:54)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:47:55)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:47:57)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:48:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:48:03)
Show buried residues

Minimal score value
-3.6063
Maximal score value
1.5132
Average score
-0.5735
Total score value
-132.4676

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8136
2 V A -0.4625
3 Q A -0.7928
4 L A 0.0000
5 V A 1.2865
6 E A 0.0000
7 S A -0.1170
8 G A -0.2586
9 G A 0.1546
10 G A 0.4449
11 L A 1.0915
12 V A 0.0000
13 Q A -1.2330
14 P A -1.4776
15 G A -1.0783
16 G A -0.9680
17 S A -1.2029
18 L A 0.0000
19 K A -1.7932
20 L A 0.0000
21 S A -0.2852
22 C A 0.0000
23 A A -0.0028
24 A A 0.0000
25 S A -0.1296
26 G A -0.0402
27 F A 0.9614
28 T A -0.0241
29 F A 0.0000
30 S A -0.6850
31 N A -0.6950
32 F A 0.2686
33 G A 0.1369
34 V A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A 0.0000
41 P A -1.4970
42 D A -2.3890
43 K A -1.8642
44 R A -1.0382
45 L A 0.0000
46 E A 0.0000
47 F A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.0000
51 T A 0.0000
52 N A -0.3375
53 S A -0.2758
54 Y A 0.2277
55 G A -0.5708
56 D A -0.6863
57 S A -0.1379
58 S A 0.3106
59 Y A 1.1700
60 Y A 0.5376
61 P A 0.1952
62 D A 0.0748
63 S A -0.1701
64 V A -0.8221
65 K A -2.2490
66 G A -2.2423
67 R A -2.4993
68 F A 0.0000
69 T A -0.5191
70 I A 0.0000
71 S A -0.8255
72 R A -1.5851
73 D A -2.4297
74 N A -1.8350
75 A A -1.4586
76 K A -2.3675
77 N A -1.6291
78 T A -0.9810
79 L A 0.0000
80 Y A -0.5336
81 L A 0.0000
82 Q A -1.3917
83 M A 0.0000
84 S A -1.7161
85 S A -1.5432
86 L A 0.0000
87 K A -1.3643
88 S A -1.4128
89 E A -2.2137
90 D A 0.0000
91 T A -0.3285
92 A A 0.0000
93 M A 0.6699
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 T A 0.0000
98 R A 0.0000
99 E A 0.0000
100 A A 0.7980
101 Y A 1.0846
102 G A -0.0595
103 N A 0.0000
104 F A 0.0000
105 F A 0.0000
106 A A 0.0000
107 Y A -0.1265
108 W A -0.5166
109 G A 0.0000
110 Q A -0.8564
111 G A -0.0841
112 T A 0.0000
113 L A 1.5132
114 V A 0.0000
115 T A 0.5133
116 V A -0.0980
117 S A -0.3672
118 A A -0.5329
1 D B -0.0171
2 V B 0.0000
3 L B 0.7997
4 M B 0.0000
5 T B -0.4818
6 Q B -0.2969
7 T B -0.1188
8 P B 0.2724
9 L B 0.9935
10 S B -0.3406
11 L B -0.4592
12 S B -1.2477
13 V B 0.0000
14 S B -2.4215
15 L B -2.5574
16 G B -2.1972
17 D B -3.0815
18 Q B -2.8672
19 A B 0.0000
20 S B -0.9096
21 I B 0.0000
22 S B -0.9140
23 C B 0.0000
24 R B -2.2769
25 S B -1.1567
26 S B -0.7173
27 Q B -0.8165
28 S B 0.2122
29 V B 1.3433
30 V B 1.4255
31 N B 0.1672
32 R B -0.8924
33 N B -1.7594
34 G B -2.0359
35 N B -2.0373
36 T B -1.3352
37 Y B 0.0000
38 L B -0.3362
39 E B 0.0000
40 W B 0.0000
41 Y B 0.0000
42 L B 0.0000
43 Q B 0.0000
44 K B -1.4427
45 P B -1.0536
46 G B -1.0747
47 Q B -1.1554
48 S B 0.0000
49 P B 0.0000
50 K B 0.0000
51 L B 0.1800
52 L B 0.0000
53 I B 0.0000
54 Y B -0.6513
55 K B -1.7361
56 V B -0.6303
57 S B -1.0108
58 N B -1.6804
59 R B -1.5887
60 F B 0.6606
61 S B -0.2790
62 G B -0.7471
63 V B -1.2136
64 P B -2.1034
65 D B -2.8221
66 R B -2.2618
67 F B 0.0000
68 S B 0.0000
69 G B 0.0000
70 S B -0.5566
71 G B -1.0965
72 S B -1.0663
73 G B -1.1642
74 T B -1.3602
75 D B -1.8234
76 F B 0.0000
77 T B -0.8573
78 L B 0.0000
79 K B -1.1579
80 I B 0.0000
81 S B -2.7835
82 R B -3.6063
83 V B 0.0000
84 E B -3.2882
85 A B 0.0000
86 E B -2.4691
87 D B -3.0126
88 L B 0.0000
89 G B -1.7383
90 V B 0.0000
91 Y B 0.0000
92 Y B 0.0000
93 C B 0.0000
94 F B 0.0000
95 Q B 0.0000
96 G B 0.0000
97 S B 0.0000
98 H B -1.1879
99 V B -0.3566
100 P B 0.0000
101 P B 0.0000
102 T B 0.0000
103 F B 0.4676
104 G B 0.0000
105 G B -0.0829
106 G B -0.8188
107 T B 0.0000
108 K B -1.8782
109 L B 0.0000
110 E B -2.5415
111 I B -2.4477
112 K B -3.0658
113 R B -2.7292
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5735 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_3 -0.5735 View CSV PDB
model_8 -0.6074 View CSV PDB
model_0 -0.6191 View CSV PDB
model_4 -0.6281 View CSV PDB
input -0.6514 View CSV PDB
model_11 -0.6547 View CSV PDB
CABS_average -0.66 View CSV PDB
model_1 -0.6601 View CSV PDB
model_9 -0.6621 View CSV PDB
model_6 -0.6819 View CSV PDB
model_7 -0.6826 View CSV PDB
model_2 -0.6958 View CSV PDB
model_5 -0.7259 View CSV PDB
model_10 -0.729 View CSV PDB