Project name: 7b11ca3f755425d

Status: done

Started: 2026-07-18 21:40:40
Chain sequence(s) A: MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:55)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7b11ca3f755425d/tmp/folded.pdb                (00:01:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:41)
Show buried residues

Minimal score value
-3.3008
Maximal score value
1.856
Average score
-0.5211
Total score value
-131.3094

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.7099
2 E A 0.0464
3 I A 0.0000
4 V A 1.0315
5 M A 0.0000
6 T A -0.5332
7 Q A 0.0000
8 S A -0.4895
9 P A -0.3593
10 S A -0.8153
11 T A -0.5645
12 L A 0.3621
13 S A 0.5715
14 A A 0.0000
15 S A 0.6473
16 V A 0.7123
17 G A -0.7670
18 D A -1.5353
19 R A -1.8755
20 V A 0.0000
21 I A 1.1036
22 I A 0.0000
23 T A -0.3873
24 C A 0.0000
25 Q A -1.6229
26 A A 0.0000
27 S A -0.5632
28 E A -1.2204
29 I A 0.1035
30 I A 0.0000
31 H A -0.6665
32 S A -0.1667
33 W A 0.6868
34 L A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A 0.0000
39 Q A 0.0000
40 K A -1.5724
41 P A -1.1064
42 G A -1.6209
43 K A -2.4973
44 A A -1.5902
45 P A 0.0000
46 K A -1.7920
47 L A 0.0000
48 L A 0.0000
49 I A 0.0000
50 Y A 0.3213
51 L A 0.6519
52 A A 0.0000
53 S A -0.0196
54 T A 0.2726
55 L A 0.3871
56 A A 0.0000
57 S A -0.4842
58 G A -0.5368
59 V A 0.0000
60 P A -0.4006
61 S A -0.4580
62 R A -0.8961
63 F A 0.0000
64 S A -0.1344
65 G A 0.0000
66 S A -0.6662
67 G A -1.2555
68 S A -0.8454
69 G A -0.8296
70 A A -1.3897
71 E A -2.5003
72 F A 0.0000
73 T A -0.4064
74 L A 0.0000
75 T A 0.0459
76 I A 0.0000
77 S A -1.1145
78 S A -1.1905
79 L A 0.0000
80 Q A -1.0971
81 P A -0.8643
82 D A -1.9083
83 D A 0.0000
84 F A -0.2704
85 A A 0.0000
86 T A -0.6790
87 Y A 0.0000
88 Y A 0.0000
89 C A 0.0000
90 Q A 0.0000
91 N A 0.0000
92 V A 0.0000
93 Y A 0.6675
94 L A 0.5617
95 A A 0.2875
96 S A 0.1041
97 T A 0.0576
98 N A 0.0695
99 G A 0.1601
100 A A 0.0000
101 N A -0.1617
102 F A 0.0000
103 G A 0.0000
104 Q A -1.6715
105 G A 0.0000
106 T A 0.0000
107 K A -1.2665
108 L A 0.0000
109 T A 0.5393
110 V A 1.8241
111 L A 1.8560
112 G A 0.1571
113 G A -0.3078
114 G A -0.8104
115 G A -1.0858
116 G A -1.1976
117 S A -0.9935
118 G A -1.1736
119 G A -1.1706
120 G A -1.1772
121 G A -1.1467
122 S A -1.0084
123 G A -1.1656
124 G A -1.1752
125 G A -1.1925
126 G A -1.1706
127 S A -1.0103
128 G A -1.1797
129 G A -1.4084
130 G A -1.3977
131 G A -1.3791
132 S A -1.3655
133 E A -1.7974
134 V A -0.0144
135 Q A -0.3781
136 L A 0.0000
137 V A 0.5936
138 E A 0.1258
139 S A -0.4160
140 G A -0.6725
141 G A 0.0705
142 G A 0.6010
143 L A 1.2911
144 V A 0.0000
145 Q A -1.3677
146 P A -1.5597
147 G A -1.3807
148 G A -0.9980
149 S A -1.3403
150 L A -1.0591
151 R A -2.1059
152 L A 0.0000
153 S A -0.5448
154 C A 0.0000
155 T A -0.2927
156 A A 0.0000
157 S A -0.3492
158 G A -0.6651
159 F A -0.4459
160 S A -0.9919
161 L A 0.0000
162 T A -1.4078
163 D A -1.5693
164 Y A -0.6773
165 Y A -0.2069
166 Y A 0.0000
167 M A 0.0000
168 T A 0.0000
169 W A 0.0000
170 V A 0.0000
171 R A 0.0000
172 Q A -0.6178
173 A A -1.0466
174 P A -1.1776
175 G A -1.4502
176 K A -2.4004
177 G A -1.7906
178 L A 0.0000
179 E A -1.1811
180 W A 0.0000
181 V A 0.0000
182 G A 0.0000
183 F A 0.0000
184 I A 0.0000
185 D A -1.5997
186 P A -1.9352
187 D A -3.0638
188 D A -3.3008
189 D A -3.0904
190 P A -1.4622
191 Y A -0.5152
192 Y A -0.3336
193 A A 0.0000
194 T A -0.4723
195 W A -0.3251
196 A A 0.0000
197 K A -1.8622
198 G A -1.5109
199 R A -1.3723
200 F A 0.0000
201 T A -0.8680
202 I A 0.0000
203 S A -1.0293
204 R A -1.4844
205 D A -2.1077
206 N A -2.3880
207 S A -1.9279
208 K A -2.5522
209 N A -1.8475
210 T A 0.0000
211 L A 0.0000
212 Y A -0.6352
213 L A 0.0000
214 Q A -1.2468
215 M A 0.0000
216 N A -1.5386
217 S A -1.2855
218 L A 0.0000
219 R A -2.1752
220 A A -1.6540
221 E A -2.2043
222 D A 0.0000
223 T A -0.3383
224 A A 0.0000
225 V A 0.8550
226 Y A 0.0000
227 Y A 0.0000
228 C A 0.0000
229 A A 0.0000
230 G A 0.0000
231 G A 0.0000
232 D A -1.1902
233 H A -1.4411
234 N A -1.8149
235 S A 0.0000
236 G A 0.0000
237 W A -0.1771
238 G A 0.0000
239 L A 0.0000
240 D A -1.6754
241 I A -0.5143
242 W A -0.6022
243 G A 0.0000
244 Q A -1.4194
245 G A 0.0000
246 T A 0.5185
247 L A 1.7074
248 V A 0.0000
249 T A 0.3482
250 V A 0.0000
251 S A -0.6798
252 S A -0.5041
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3215 2.2885 View CSV PDB
4.5 -0.3614 2.2885 View CSV PDB
5.0 -0.4099 2.2885 View CSV PDB
5.5 -0.4582 2.2885 View CSV PDB
6.0 -0.4979 2.2885 View CSV PDB
6.5 -0.5245 2.2885 View CSV PDB
7.0 -0.5394 2.2885 View CSV PDB
7.5 -0.5471 2.2885 View CSV PDB
8.0 -0.5507 2.2885 View CSV PDB
8.5 -0.5504 2.2885 View CSV PDB
9.0 -0.5442 2.2885 View CSV PDB