Project name: 96b492b44a0142e [mutate: CN50B]

Status: done

Started: 2026-07-09 01:51:38
Chain sequence(s) A: QVQLVESGGGVVQPGGSLRLSCAASGFTFTNYVMHWVRQAPGKGLEWVAVISHDGNNKYYVDVSVKGRFTISRDSKNTLYLQMNSLRAEDTAVYYCAREGIDFWSGLNWFDPWGQGTLVTVSS
B: EIVLTQSPGTLSLSPGERATLSCRASQSITGSYLAWYQQKPGQAPRLLICGASSWATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSSSPITFGQGTRLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues CN50B
Energy difference between WT (input) and mutated protein (by FoldX) 1.18941 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:45)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:49)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7b78d4c45e2ad40/tmp/folded.pdb                (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)
Show buried residues

Minimal score value
-3.4086
Maximal score value
2.5735
Average score
-0.5601
Total score value
-129.3853

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.0996
2 V A -0.3115
3 Q A -0.5454
4 L A 0.0000
5 V A 0.5891
6 E A 0.0000
7 S A -0.3755
8 G A -0.8287
9 G A 0.0113
10 G A 0.8091
11 V A 1.4974
12 V A 0.0000
13 Q A -1.2945
14 P A -1.5069
15 G A -1.4386
16 G A -1.0269
17 S A -1.5266
18 L A -1.0992
19 R A -2.3323
20 L A 0.0000
21 S A -0.5096
22 C A 0.0000
23 A A -0.0284
24 A A 0.0000
25 S A -0.5454
26 G A -0.6544
27 F A -0.3153
28 T A -0.5613
29 F A 0.0000
30 T A -1.6181
31 N A -1.3953
32 Y A -0.4865
33 V A -0.1928
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.4494
39 Q A -0.7659
40 A A -1.1326
41 P A -0.8925
42 G A -1.5000
43 K A -2.3475
44 G A -1.5094
45 L A 0.0000
46 E A -0.9987
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 V A 0.2702
51 I A 0.0000
52 S A -1.6680
53 H A -2.1397
54 D A -3.0077
55 G A -2.4064
56 N A -2.8096
57 N A -2.3454
58 K A -1.1009
59 Y A 0.3652
60 Y A 0.0971
61 V A -0.4056
62 D A -1.0718
63 V A 0.1284
64 S A -0.6022
65 V A 0.0000
66 K A -1.6524
67 G A -1.4871
68 R A -1.4885
69 F A 0.0000
70 T A -1.1106
71 I A 0.0000
72 S A -0.7454
73 R A -1.3043
74 D A -1.5286
75 S A -1.7292
76 K A -2.1493
77 N A -1.3968
78 T A 0.0000
79 L A 0.0000
80 Y A -0.6318
81 L A 0.0000
82 Q A -1.7387
83 M A 0.0000
84 N A -2.1323
85 S A -1.4577
86 L A 0.0000
87 R A -2.0883
88 A A -1.6007
89 E A -2.1260
90 D A 0.0000
91 T A -0.3829
92 A A 0.0000
93 V A 0.5313
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.1549
99 E A 0.0000
100 G A 0.0000
101 I A 2.2214
102 D A 1.6550
103 F A 2.5735
104 W A 2.2253
105 S A 1.2529
106 G A 1.0198
107 L A 1.2695
108 N A 0.0000
109 W A 0.3160
110 F A 0.0000
111 D A -0.9657
112 P A -1.0943
113 W A 0.0000
114 G A 0.0000
115 Q A -1.3196
116 G A 0.0000
117 T A 0.3272
118 L A 1.2976
119 V A 0.0000
120 T A 0.3530
121 V A 0.0000
122 S A -0.7160
123 S A -0.6485
1 E B -1.4338
2 I B -0.1788
3 V B 0.8208
4 L B 0.0000
5 T B -0.6603
6 Q B 0.0000
7 S B -0.8337
8 P B -0.4605
9 G B -0.6441
10 T B -0.7549
11 L B -0.4749
12 S B -0.7784
13 L B -0.7831
14 S B -1.1603
15 P B -1.7305
16 G B -2.0217
17 E B -2.5071
18 R B -3.0739
19 A B 0.0000
20 T B -0.5485
21 L B 0.0000
22 S B -0.9807
23 C B 0.0000
24 R B -2.3480
25 A B 0.0000
26 S B -0.9603
27 Q B -1.6542
28 S B -1.3780
29 I B 0.0000
30 T B -0.5475
31 G B -0.5443
32 S B -0.5597
33 Y B 0.1134
34 L B 0.0000
35 A B 0.0000
36 W B 0.0000
37 Y B 0.0000
38 Q B 0.0000
39 Q B 0.0000
40 K B -1.3490
41 P B -0.9859
42 G B -1.4212
43 Q B -2.1431
44 A B -1.5982
45 P B 0.0000
46 R B -2.2042
47 L B 0.0000
48 L B 0.0000
49 I B 0.0000
50 N B 0.0000 mutated: CN50B
51 G B -0.1320
52 A B 0.0000
53 S B -0.1572
54 S B 0.2629
55 W B 0.7430
56 A B 0.1198
57 T B -0.0285
58 G B -0.4341
59 I B -0.4235
60 P B -0.9028
61 D B -2.0447
62 R B -2.0837
63 F B 0.0000
64 S B -0.4217
65 G B 0.0000
66 S B -0.6889
67 G B -1.1223
68 S B -1.1025
69 G B -1.2475
70 T B -1.7420
71 D B -2.1965
72 F B 0.0000
73 T B -0.8064
74 L B 0.0000
75 T B -0.7912
76 I B 0.0000
77 S B -2.3919
78 R B -3.4086
79 L B 0.0000
80 E B -2.4996
81 P B -1.5275
82 E B -2.3114
83 D B 0.0000
84 F B -0.8483
85 A B 0.0000
86 V B -0.4041
87 Y B 0.0000
88 Y B 0.0000
89 C B 0.0000
90 Q B 0.0000
91 Q B 0.0000
92 Y B 0.0000
93 S B 0.0686
94 S B -0.3362
95 S B -0.2962
96 P B -0.5295
97 I B 0.0720
98 T B 0.0588
99 F B 0.1958
100 G B 0.0000
101 Q B -1.0742
102 G B 0.0000
103 T B 0.0000
104 R B -1.2706
105 L B 0.0000
106 E B -1.2625
107 I B 0.2247
108 K B -1.1748
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4646 6.5651 View CSV PDB
4.5 -0.5076 6.4834 View CSV PDB
5.0 -0.5597 6.3956 View CSV PDB
5.5 -0.6128 6.3057 View CSV PDB
6.0 -0.6583 6.2151 View CSV PDB
6.5 -0.6885 6.1245 View CSV PDB
7.0 -0.7025 6.0347 View CSV PDB
7.5 -0.7053 5.9474 View CSV PDB
8.0 -0.7013 5.8669 View CSV PDB
8.5 -0.6914 5.8022 View CSV PDB
9.0 -0.6754 5.7618 View CSV PDB