Project name: 7ca43f753e6629a

Status: done

Started: 2026-05-17 19:33:17
Chain sequence(s) A: MLKDEVIKQISTPLTSPAFPRGPYKFHNREYFNIVYRTDMDALRKVVPEPLEIDEPLVRFEIMAMHDTSGLGCYTESGQAIPVSFNGVKGDYLHMMYLDNEPAIAVGRELSAYPKKLGYPKLFVDSDTLVGTLDYGKLRVATATMGYKHKALDANEAKDQICRPNYMLKIIPNYDGSPRICELINAKITDVTVHEAWTGPTRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEVIYDYLK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:32)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7ca43f753e6629a/tmp/folded.pdb                (00:04:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:34)
Show buried residues

Minimal score value
-3.487
Maximal score value
1.9175
Average score
-0.7061
Total score value
-172.2826

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.2042
2 L A 0.8839
3 K A -1.2593
4 D A -1.9120
5 E A -1.0123
6 V A 0.4178
7 I A 0.4936
8 K A -1.4300
9 Q A -0.7541
10 I A -0.1613
11 S A -0.4418
12 T A -0.0063
13 P A -0.1500
14 L A 0.3277
15 T A -0.0596
16 S A -0.2417
17 P A -0.4413
18 A A -0.3825
19 F A 0.0000
20 P A -1.2854
21 R A -2.0323
22 G A -1.5984
23 P A -1.2767
24 Y A 0.0000
25 K A -1.6899
26 F A 0.0000
27 H A -2.2244
28 N A -2.0228
29 R A 0.0000
30 E A -0.7591
31 Y A 0.0000
32 F A 0.0000
33 N A 0.0000
34 I A 0.0000
35 V A 0.5152
36 Y A 0.0000
37 R A -1.8644
38 T A 0.0000
39 D A -1.9746
40 M A -1.8630
41 D A -2.8027
42 A A -2.3930
43 L A 0.0000
44 R A -3.4870
45 K A -2.7550
46 V A -1.6212
47 V A -1.4473
48 P A -1.6063
49 E A -2.2603
50 P A -1.6254
51 L A 0.0000
52 E A -2.9837
53 I A -2.0614
54 D A -2.6254
55 E A -2.4807
56 P A 0.0000
57 L A -0.8905
58 V A 0.0000
59 R A 0.0781
60 F A 0.0000
61 E A 0.0000
62 I A 0.0000
63 M A 0.0000
64 A A 0.0000
65 M A 0.0000
66 H A -1.8144
67 D A -2.6845
68 T A 0.0000
69 S A -1.1972
70 G A -1.2979
71 L A 0.0000
72 G A -0.7962
73 C A -0.4486
74 Y A 0.0000
75 T A 0.0000
76 E A 0.0000
77 S A 0.0000
78 G A 0.0000
79 Q A 0.0000
80 A A 0.0000
81 I A 0.0000
82 P A -0.9433
83 V A 0.0000
84 S A -1.1330
85 F A -0.8011
86 N A -1.3167
87 G A -0.7574
88 V A 0.3285
89 K A -1.0296
90 G A 0.0000
91 D A 0.0000
92 Y A 0.0000
93 L A 0.0000
94 H A 0.0373
95 M A -0.0832
96 M A 0.0000
97 Y A 0.0000
98 L A 0.0000
99 D A -0.7651
100 N A -1.0301
101 E A -1.9263
102 P A -1.2749
103 A A 0.0000
104 I A -1.2533
105 A A -1.3535
106 V A 0.0000
107 G A 0.0000
108 R A -1.8693
109 E A -1.7943
110 L A -0.5603
111 S A -0.9190
112 A A 0.0000
113 Y A -0.5529
114 P A -0.2457
115 K A 0.0000
116 K A -0.7230
117 L A -0.0775
118 G A 0.0000
119 Y A 0.0198
120 P A 0.0000
121 K A -0.8233
122 L A 0.1460
123 F A 1.0139
124 V A 0.5320
125 D A -1.4464
126 S A -1.4297
127 D A -2.1966
128 T A -1.0891
129 L A 0.0000
130 V A -0.0983
131 G A 0.0000
132 T A 0.0000
133 L A 0.0000
134 D A -0.7599
135 Y A -0.1567
136 G A -0.7668
137 K A -1.5471
138 L A -0.2150
139 R A -0.7657
140 V A 0.0000
141 A A 0.0000
142 T A -0.7791
143 A A 0.0000
144 T A -0.7610
145 M A 0.0000
146 G A -1.3375
147 Y A -1.0256
148 K A -1.6819
149 H A -2.1878
150 K A -2.3846
151 A A -1.4314
152 L A -1.6152
153 D A -2.9367
154 A A -2.4086
155 N A -3.1255
156 E A -3.3196
157 A A 0.0000
158 K A -2.6124
159 D A -3.2160
160 Q A -1.8062
161 I A -0.9965
162 C A -1.4843
163 R A -1.2108
164 P A 0.0000
165 N A -0.6379
166 Y A 0.0000
167 M A 0.0000
168 L A 0.7933
169 K A 0.9418
170 I A 1.9175
171 I A 0.7698
172 P A -0.3925
173 N A -1.0398
174 Y A -0.1153
175 D A -1.7884
176 G A -1.3815
177 S A -1.1914
178 P A -0.5259
179 R A -1.2536
180 I A 0.5899
181 C A 0.8764
182 E A 0.6585
183 L A 0.0000
184 I A 0.0000
185 N A -0.7347
186 A A 0.0000
187 K A -1.8674
188 I A 0.0000
189 T A -1.1140
190 D A -1.8380
191 V A -0.7929
192 T A -0.8264
193 V A -0.9263
194 H A -1.1177
195 E A -1.2612
196 A A 0.0000
197 W A -0.9375
198 T A -1.0269
199 G A -1.2186
200 P A -1.0456
201 T A 0.0000
202 R A -2.2246
203 L A 0.0000
204 Q A -1.1143
205 L A -0.7292
206 F A -0.5647
207 D A -1.8209
208 H A -0.6456
209 A A -0.0627
210 M A 0.7835
211 A A 0.0000
212 P A -0.8320
213 L A 0.0000
214 N A -1.5834
215 D A -2.2300
216 L A 0.0000
217 P A -1.7378
218 V A -1.8148
219 K A -2.5491
220 E A -2.3945
221 I A -0.5412
222 V A 1.0793
223 S A 0.3537
224 S A 0.0000
225 S A 0.0000
226 H A 0.0000
227 I A 0.0000
228 L A -0.7075
229 A A 0.0000
230 D A -1.5407
231 I A 0.0000
232 I A -0.8131
233 L A -0.7334
234 P A -1.6751
235 R A -2.3118
236 A A -1.4777
237 E A -1.5747
238 V A 0.7697
239 I A 0.7871
240 Y A 0.5138
241 D A 0.3926
242 Y A 0.3219
243 L A 0.1566
244 K A -1.1270
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4118 3.2828 View CSV PDB
4.5 -0.5022 3.2741 View CSV PDB
5.0 -0.6116 3.2611 View CSV PDB
5.5 -0.7215 3.2471 View CSV PDB
6.0 -0.8128 3.237 View CSV PDB
6.5 -0.8742 3.2362 View CSV PDB
7.0 -0.9079 3.2468 View CSV PDB
7.5 -0.9236 3.2661 View CSV PDB
8.0 -0.9281 3.2896 View CSV PDB
8.5 -0.9213 3.3148 View CSV PDB
9.0 -0.8995 3.3404 View CSV PDB