Project name: 7d79fa79e5d31aa

Status: done

Started: 2026-02-24 08:14:10
Chain sequence(s) A: DIVMTQSHKFMSTSVGDRVSITCKASQDIYNYVHWYQEKPGQCPKLLIYGASNRYTGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQSVFFSSTFGGGTKLEIK
B: EVQLVESGGGLVKPGGSLKVSCAASGFTLTSYVLSWVRQTPEKRLEWVATINEVGAYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARVTFVAFDVWGAGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:56)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7d79fa79e5d31aa/tmp/folded.pdb                (00:03:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:46)
Show buried residues

Minimal score value
-3.1802
Maximal score value
3.0974
Average score
-0.4938
Total score value
-110.6019

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.6746
2 I A 0.0000
3 V A 0.8509
4 M A 0.0000
5 T A -0.7023
6 Q A -1.1767
7 S A -0.9900
8 H A -1.1963
9 K A -1.4372
10 F A 0.4434
11 M A -0.1115
12 S A -0.4104
13 T A 0.0000
14 S A -0.9870
15 V A -0.2721
16 G A -1.5701
17 D A -2.4605
18 R A -2.7972
19 V A 0.0000
20 S A -0.5320
21 I A 0.0000
22 T A -0.8375
23 C A 0.0000
24 K A -1.8353
25 A A -0.9681
26 S A -0.9090
27 Q A -1.5567
28 D A -1.9217
29 I A 0.0000
30 Y A -0.0512
31 N A -0.8112
32 Y A 0.9356
33 V A 0.0000
34 H A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 E A 0.0000
39 K A -1.4751
40 P A -1.0340
41 G A -1.2439
42 Q A -1.7159
43 C A -0.8484
44 P A 0.0000
45 K A -1.2067
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.2429
50 G A 0.0826
51 A A 0.0000
52 S A -1.0809
53 N A -1.2823
54 R A -1.6776
55 Y A -0.7154
56 T A -0.5363
57 G A -0.8324
58 V A 0.0000
59 P A -1.2754
60 D A -2.1822
61 R A -1.8172
62 L A 0.0000
63 T A -0.9547
64 G A 0.0000
65 S A -0.8557
66 G A -1.0594
67 S A -0.9112
68 G A -1.1261
69 T A -1.7926
70 D A -2.1405
71 F A 0.0000
72 T A -0.6690
73 L A 0.0000
74 T A -0.6756
75 I A 0.0000
76 S A -2.1913
77 N A -2.4800
78 V A 0.0000
79 E A -1.8185
80 S A -1.1520
81 E A -1.8819
82 D A 0.0000
83 L A -0.6820
84 A A 0.0000
85 D A -0.8354
86 Y A 0.0000
87 F A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 S A 1.4924
92 V A 0.0000
93 F A 2.9448
94 F A 3.0974
95 S A 1.4619
96 S A 0.0000
97 T A -0.0973
98 F A 0.0000
99 G A 0.0000
100 G A -1.7537
101 G A 0.0000
102 T A 0.0000
103 K A -0.6852
104 L A 0.0000
105 E A -0.8742
106 I A -1.0146
107 K A -1.5260
1 E B -2.0972
2 V B -1.2035
3 Q B -1.0912
4 L B 0.0000
5 V B 1.4220
6 E B 0.0000
7 S B -0.2344
8 G B -0.9176
9 G B -0.4036
10 G B 0.2663
11 L B 1.0918
12 V B -0.3665
13 K B -1.9219
14 P B -2.0000
15 G B -1.5972
16 G B -1.0863
17 S B -1.0577
18 L B -0.8919
19 K B -1.8291
20 V B 0.0000
21 S B -0.3431
22 C B 0.0000
23 A B -0.0745
24 A B 0.0000
25 S B -0.8501
26 G B -1.2399
27 F B -0.5127
28 T B -0.1997
29 L B 0.0000
30 T B -0.1013
31 S B 0.0054
32 Y B 0.3475
33 V B 0.8307
34 L B 0.0000
35 S B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B 0.0000
40 T B 0.0000
41 P B -2.0144
42 E B -3.1063
43 K B -3.1410
44 R B -3.1802
45 L B 0.0000
46 E B -1.0681
47 W B 0.0000
48 V B 0.0000
49 A B 0.0000
50 T B 0.5377
51 I B 0.0000
52 N B 0.5558
53 E B 0.3187
54 V B 1.4387
55 G B 0.6823
56 A B 0.9782
57 Y B 1.4876
58 T B 0.9249
59 Y B 0.5559
60 Y B -0.5230
61 P B -1.6260
62 D B -2.7742
63 S B -1.8008
64 V B 0.0000
65 K B -2.6485
66 G B -1.7522
67 R B -1.5371
68 F B 0.0000
69 T B -0.8877
70 I B 0.0000
71 S B -0.1438
72 R B -0.7015
73 D B -1.1530
74 N B -1.2149
75 A B -1.2647
76 K B -2.2045
77 N B -1.6496
78 T B -0.8926
79 L B 0.0000
80 Y B -0.5262
81 L B 0.0000
82 Q B -1.4837
83 M B 0.0000
84 S B -1.1826
85 S B -1.2680
86 L B 0.0000
87 R B -3.0123
88 S B -2.3322
89 E B -2.5946
90 D B 0.0000
91 T B -0.8426
92 A B 0.0000
93 M B 0.0094
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 A B 0.0000
98 R B 0.0000
99 V B 1.0634
100 T B 1.5329
101 F B 2.6800
102 V B 2.6298
103 A B 0.0000
104 F B 0.0000
105 D B 0.2743
106 V B -0.1390
107 W B 0.0000
108 G B 0.0000
109 A B 0.0872
110 G B 0.1973
111 T B 0.0304
112 T B 0.0521
113 V B 0.0000
114 T B -0.2680
115 V B 0.0000
116 S B -0.9665
117 S B -0.9257
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4908 6.3407 View CSV PDB
4.5 -0.538 6.3407 View CSV PDB
5.0 -0.5916 6.3407 View CSV PDB
5.5 -0.6412 6.3407 View CSV PDB
6.0 -0.6754 6.3407 View CSV PDB
6.5 -0.6869 6.3407 View CSV PDB
7.0 -0.6781 6.3407 View CSV PDB
7.5 -0.6571 6.3407 View CSV PDB
8.0 -0.6295 6.3407 View CSV PDB
8.5 -0.5956 6.3406 View CSV PDB
9.0 -0.5543 6.3405 View CSV PDB