Project name: 7da81d915977207

Status: done

Started: 2026-07-17 11:47:17
Chain sequence(s) A: GDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGATKWTFEACR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7da81d915977207/tmp/folded.pdb                (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:15)
Show buried residues

Minimal score value
-3.2035
Maximal score value
1.3701
Average score
-0.5939
Total score value
-121.751

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
225 G A -1.6413
226 D A -2.2545
227 K A -2.6802
228 F A 0.0000
229 Q A -1.0502
230 L A 0.0000
231 T A -0.1700
232 F A 0.0000
233 P A 0.3063
234 L A 0.8771
235 R A -0.3309
236 T A 0.0000
237 N A -0.8787
238 Y A 0.4263
239 M A 0.0000
240 Y A 0.2709
241 A A 0.0000
242 K A -0.9331
243 V A 0.0000
244 K A -2.8111
245 K A -2.6542
246 S A -1.7513
247 L A 0.0000
248 P A -1.7035
249 E A -2.2371
250 M A 0.0000
251 Y A 0.2522
252 A A -0.5794
253 F A 0.0000
254 T A 0.0000
255 V A 0.0000
256 C A 0.0000
257 M A 0.0000
258 W A 0.0000
259 L A 0.0000
260 K A -1.3071
261 S A 0.0000
262 S A -1.1857
263 A A -0.4260
264 T A -0.5951
265 P A -0.9086
266 G A 0.0000
267 V A 0.0000
268 G A 0.0000
269 T A 0.0000
270 P A 0.0000
271 F A 0.0000
272 S A 0.0000
273 Y A 0.0000
274 A A 0.0000
275 V A 0.0000
276 P A -0.4887
277 G A -0.6027
278 Q A -1.1656
279 A A -0.9768
280 N A -1.4038
281 E A 0.0000
282 L A 0.0000
283 V A 0.0000
284 L A 0.0000
285 I A 0.0000
286 E A -0.7600
287 W A -0.2731
288 G A -0.9920
289 N A -1.9269
290 N A -2.0950
291 P A -1.2738
292 M A 0.0000
293 E A -0.8582
294 I A 0.0000
295 L A 0.0000
296 I A 0.0000
297 N A -1.4185
298 D A -2.0421
299 K A -1.3580
300 V A 0.0426
301 A A -0.8282
302 K A -1.6900
303 L A 0.0000
304 P A -0.4284
305 F A 0.0000
306 V A 1.3701
307 I A 0.0000
308 N A -1.0441
309 D A -1.8561
310 G A -1.8937
311 K A -2.2717
312 W A -1.1433
313 H A -0.8259
314 H A 0.0000
315 I A 0.0000
316 C A 0.0000
317 V A 0.0000
318 T A 0.0000
319 W A 0.0000
320 T A 0.0000
321 T A 0.0000
322 R A -2.5123
323 D A -3.2035
324 G A 0.0000
325 V A -2.0062
326 W A 0.0000
327 E A -0.9056
328 A A 0.0000
329 Y A 0.0000
330 Q A -0.7811
331 D A -1.2263
332 G A -0.6043
333 T A -0.8460
334 Q A -1.2902
335 G A -1.2184
336 G A -1.0123
337 S A -1.1634
338 G A -1.7605
339 E A -3.1424
340 N A -2.7024
341 L A 0.0000
342 A A 0.0000
343 P A -1.2368
344 Y A 0.3246
345 H A -0.1152
346 P A -0.2173
347 I A 0.0000
348 K A -1.6245
349 P A -1.7569
350 Q A -1.8752
351 G A 0.0000
352 V A -0.1388
353 L A 0.0000
354 V A 0.0000
355 L A 0.0000
356 G A 0.0000
357 Q A 0.0000
358 E A 0.0000
359 Q A 0.0000
360 D A -1.8415
361 T A -0.5964
362 L A 0.5551
363 G A 0.2184
364 G A -0.3004
365 G A -0.9905
366 F A -0.8236
367 D A -1.2504
368 A A -0.6607
369 T A -0.5296
370 Q A 0.0000
371 A A 0.0000
372 F A 0.0000
373 V A 0.2196
374 G A -0.2169
375 E A -0.4985
376 L A 0.0000
377 A A 0.0000
378 H A -0.5678
379 F A 0.0000
380 N A 0.0000
381 I A 0.0000
382 W A 0.0000
383 D A -1.8180
384 R A -1.4452
385 K A -0.9691
386 L A 0.0000
387 T A -0.4324
388 P A -0.4777
389 G A -0.2420
390 E A -0.4670
391 V A 0.0000
392 Y A 0.4132
393 N A -0.1146
394 L A 0.0000
395 A A -0.0190
396 T A 0.0476
397 C A -0.2375
398 S A -0.3849
399 T A -0.8287
400 K A -1.5770
401 A A -0.5918
402 L A -0.3056
403 S A -0.5630
404 G A -0.9074
405 N A -1.5897
406 V A 0.0000
407 I A 0.0000
408 A A -0.8223
409 W A 0.0000
410 A A -1.5800
411 E A -2.3267
412 S A -1.6139
413 H A -2.1053
414 I A 0.0000
415 E A -1.1769
416 I A -0.1207
417 Y A 0.5133
418 G A 0.0041
419 G A -0.0903
420 A A 0.0000
421 T A -0.3982
422 K A -0.8711
423 W A 0.0700
424 T A -0.7316
425 F A 0.0000
426 E A -2.7314
427 A A -1.6390
428 C A -0.9356
429 R A -2.2183
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3583 2.0559 View CSV PDB
4.5 -0.4059 2.0403 View CSV PDB
5.0 -0.4632 2.0143 View CSV PDB
5.5 -0.5196 1.9812 View CSV PDB
6.0 -0.5639 1.9464 View CSV PDB
6.5 -0.587 1.9344 View CSV PDB
7.0 -0.5872 1.9584 View CSV PDB
7.5 -0.571 2.0499 View CSV PDB
8.0 -0.545 2.2817 View CSV PDB
8.5 -0.5114 2.5206 View CSV PDB
9.0 -0.4704 2.7604 View CSV PDB