Project name: 7dd5b6ffe76680

Status: done

Started: 2026-08-17 03:09:34
Chain sequence(s) A: QGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGPPGPPGPPGPGIDMSAFAGLGPREKGPDPLQYMRA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:29)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7dd5b6ffe76680/tmp/folded.pdb                 (00:03:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:34)
Show buried residues

Minimal score value
-4.2582
Maximal score value
2.49
Average score
-1.251
Total score value
-661.7753

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.1982
2 G A -0.6167
3 L A 0.3441
4 Q A -1.1943
5 G A -1.3087
6 P A -1.4134
7 R A -2.1171
8 G A -0.8352
9 L A 0.6342
10 P A -0.0992
11 G A -0.4235
12 T A -0.4227
13 P A -0.8848
14 G A -1.1767
15 T A -1.3676
16 D A -2.4722
17 G A -1.9885
18 P A -1.8201
19 K A -2.4098
20 G A -1.4936
21 A A -0.8337
22 S A -0.7849
23 G A -0.7864
24 P A -0.6358
25 A A -0.5234
26 G A -0.8132
27 P A -0.7263
28 P A -0.8493
29 G A -1.0335
30 A A -0.9615
31 Q A -1.5922
32 G A -1.2637
33 P A -0.7613
34 P A -0.6260
35 G A -0.3086
36 L A 0.6635
37 Q A -0.5989
38 G A -0.3356
39 M A 0.2792
40 P A -0.8509
41 G A -1.7895
42 E A -2.9727
43 R A -3.0583
44 G A -1.8907
45 A A -0.6630
46 A A 0.0110
47 G A 0.4347
48 I A 1.6901
49 A A 0.4558
50 G A -0.5680
51 P A -1.3878
52 K A -2.5603
53 G A -2.7450
54 D A -3.6563
55 R A -3.2615
56 G A -2.3814
57 D A -2.1503
58 V A -0.1865
59 G A -1.4327
60 E A -2.8060
61 K A -2.9529
62 G A -2.3824
63 P A -2.0375
64 E A -2.4544
65 G A -1.8817
66 A A -1.0749
67 P A -1.3352
68 G A -2.0496
69 K A -3.0773
70 D A -3.3313
71 G A -2.8958
72 G A -2.2189
73 R A -2.2658
74 G A -1.2143
75 L A 0.5550
76 T A 0.2027
77 G A -0.1452
78 P A 0.4474
79 I A 1.3392
80 G A 0.1459
81 P A -0.3520
82 P A -0.6592
83 G A -0.8775
84 P A -0.8022
85 A A -0.8302
86 G A -1.4761
87 A A -1.6758
88 N A -2.7560
89 G A -3.2338
90 E A -3.7804
91 K A -3.3983
92 G A -3.0046
93 E A -2.4208
94 V A 0.2017
95 G A -0.5843
96 P A -0.5654
97 P A -0.5114
98 G A -0.9157
99 P A -0.7346
100 A A -0.5319
101 G A -0.6918
102 S A -0.5333
103 A A -0.6848
104 G A -1.0641
105 A A -1.1691
106 R A -2.2398
107 G A -1.5408
108 A A -1.0654
109 P A -1.6536
110 G A -2.4674
111 E A -3.3262
112 R A -3.6374
113 G A -3.1942
114 E A -2.9455
115 T A -1.7528
116 G A -1.2321
117 P A -1.0408
118 P A -0.9201
119 G A -0.8328
120 P A -0.4933
121 A A 0.1345
122 G A 0.3794
123 F A 1.4827
124 A A 0.3910
125 G A -0.4544
126 P A -0.5336
127 P A -1.1057
128 G A -1.3155
129 A A -1.4196
130 D A -2.7225
131 G A -2.6714
132 Q A -2.2825
133 P A -1.9880
134 G A -2.1384
135 A A -1.3896
136 K A -2.8342
137 G A -2.8822
138 E A -3.1450
139 Q A -3.2182
140 G A -2.4755
141 E A -2.3797
142 A A -1.7484
143 G A -1.9528
144 Q A -2.3265
145 K A -3.0014
146 G A -2.5170
147 D A -2.4757
148 A A -1.3754
149 G A -0.9742
150 A A -0.6003
151 P A -0.8082
152 G A -1.0979
153 P A -1.2475
154 Q A -1.7796
155 G A -1.3462
156 P A -0.9906
157 S A -0.8813
158 G A -0.7748
159 A A -0.5229
160 P A -0.8433
161 G A -1.1080
162 P A -1.2523
163 Q A -1.7500
164 G A -1.3162
165 P A -0.7024
166 T A -0.2832
167 G A 0.1614
168 V A 1.3167
169 T A 0.0980
170 G A -0.7187
171 P A -1.2177
172 K A -2.4337
173 G A -1.8975
174 A A -1.6016
175 R A -2.5676
176 G A -1.7118
177 A A -1.3021
178 Q A -1.8275
179 G A -1.2280
180 P A -0.9360
181 P A -0.8516
182 G A -0.7370
183 A A -0.1832
184 T A 0.0093
185 G A 0.2828
186 F A 1.4811
187 P A 0.3523
188 G A -0.1945
189 A A -0.3041
190 A A -0.4612
191 G A -0.9717
192 R A -1.3375
193 V A 0.4492
194 G A -0.3621
195 P A -0.5393
196 P A -0.6954
197 G A -1.1859
198 S A -1.4154
199 N A -2.1047
200 G A -1.9347
201 N A -2.1036
202 P A -1.4796
203 G A -1.2092
204 P A -0.9583
205 P A -0.8402
206 G A -0.9611
207 P A -0.8395
208 P A -0.8328
209 G A -0.9502
210 P A -1.0174
211 S A -1.3405
212 G A -2.0068
213 K A -3.0295
214 D A -3.2841
215 G A -2.4244
216 P A -2.0616
217 K A -2.6606
218 G A -1.8967
219 A A -1.8566
220 R A -2.8525
221 G A -2.3785
222 D A -2.7079
223 S A -1.7718
224 G A -1.3178
225 P A -1.2341
226 P A -1.1860
227 G A -1.6393
228 R A -2.4810
229 A A -1.6941
230 G A -1.9529
231 E A -2.3208
232 P A -1.2912
233 G A -0.7065
234 L A 0.3440
235 Q A -0.8555
236 G A -0.8287
237 P A -0.6754
238 A A -0.6834
239 G A -0.7985
240 P A -0.9365
241 P A -1.3904
242 G A -2.0768
243 E A -3.2976
244 K A -3.4320
245 G A -2.8244
246 E A -3.1426
247 P A -2.3730
248 G A -2.4670
249 D A -3.3209
250 D A -3.1197
251 G A -2.0824
252 P A -1.3444
253 S A -1.1641
254 G A -1.1723
255 A A -1.2820
256 E A -2.2538
257 G A -1.6925
258 P A -1.1766
259 P A -1.1870
260 G A -1.2577
261 P A -1.0603
262 Q A -1.3121
263 G A -0.5225
264 L A 0.7328
265 A A -0.2290
266 G A -1.2078
267 Q A -1.9233
268 R A -2.0285
269 G A -0.3815
270 I A 2.1014
271 V A 2.4900
272 G A 1.4785
273 L A 1.6202
274 P A -0.1556
275 G A -1.3712
276 Q A -2.4921
277 R A -3.4434
278 G A -3.0915
279 E A -3.5968
280 R A -2.8909
281 G A -1.0211
282 F A 1.0852
283 P A 0.4688
284 G A 0.4534
285 L A 0.9958
286 P A 0.0356
287 G A -0.5032
288 P A -0.8230
289 S A -1.1758
290 G A -1.7070
291 E A -2.6225
292 P A -2.0850
293 G A -2.3089
294 K A -2.9519
295 Q A -2.4199
296 G A -1.6440
297 A A -0.9470
298 P A -0.7416
299 G A -0.8363
300 A A -0.7115
301 S A -1.2896
302 G A -2.0666
303 D A -3.1205
304 R A -3.1962
305 G A -2.1514
306 P A -1.4748
307 P A -0.7771
308 G A -0.4620
309 P A 0.1233
310 V A 1.1628
311 G A 0.0075
312 P A -0.0995
313 P A -0.0701
314 G A -0.0603
315 L A 1.0253
316 T A 0.2363
317 G A -0.3257
318 P A -0.6358
319 A A -0.9155
320 G A -1.5904
321 E A -2.5763
322 P A -2.2048
323 G A -2.5518
324 R A -3.4331
325 E A -3.1863
326 G A -2.1155
327 S A -1.3839
328 P A -1.1943
329 G A -1.1777
330 A A -1.2772
331 D A -2.2384
332 G A -1.5982
333 P A -1.3973
334 P A -1.6797
335 G A -2.1297
336 R A -3.1643
337 D A -3.1245
338 G A -2.4343
339 A A -1.0302
340 A A -0.7583
341 G A -0.9654
342 V A -0.2629
343 K A -2.5620
344 G A -3.5265
345 D A -4.1070
346 R A -4.2582
347 G A -3.6630
348 E A -3.2138
349 T A -1.4436
350 G A -0.9499
351 A A 0.1545
352 V A 1.6257
353 G A 0.5401
354 A A 0.1618
355 P A -0.3903
356 G A -0.9172
357 A A -0.6871
358 P A -0.6838
359 G A -0.8590
360 P A -0.8192
361 P A -0.9415
362 G A -1.0424
363 S A -0.8472
364 P A -0.7586
365 G A -1.0890
366 P A -0.8131
367 A A -0.5873
368 G A -1.0720
369 P A -0.8771
370 T A -1.1101
371 G A -2.3687
372 K A -2.9189
373 Q A -3.1267
374 G A -2.9369
375 D A -3.7981
376 R A -3.7070
377 G A -3.0812
378 E A -2.7810
379 A A -1.6040
380 G A -1.4818
381 A A -1.2052
382 Q A -1.5179
383 G A -1.2708
384 P A -0.4781
385 M A 0.1446
386 G A -0.6179
387 P A -0.6111
388 S A -0.6505
389 G A -0.9520
390 P A -0.6896
391 A A -0.7333
392 G A -1.1707
393 A A -0.9667
394 R A -1.7838
395 G A -0.3452
396 I A 1.0096
397 Q A -0.4518
398 G A -0.1433
399 P A -0.7990
400 Q A -2.2275
401 G A -2.3181
402 P A -2.4740
403 R A -3.8285
404 G A -4.1117
405 D A -4.1696
406 K A -3.7438
407 G A -2.6457
408 E A -2.8202
409 A A -1.6558
410 G A -1.8159
411 E A -2.8366
412 P A -2.2764
413 G A -2.8491
414 E A -3.1531
415 R A -2.9760
416 G A -1.6083
417 L A -0.4751
418 K A -2.0122
419 G A -1.9231
420 H A -2.1156
421 R A -2.3955
422 G A -0.6775
423 F A 1.0862
424 T A 0.4359
425 G A 0.1225
426 L A 1.0633
427 Q A -0.4171
428 G A 0.0175
429 L A 1.0338
430 P A -0.0522
431 G A -0.4455
432 P A -0.5795
433 P A -0.9578
434 G A -1.2671
435 P A -1.2662
436 S A -1.4752
437 G A -2.0645
438 D A -2.7579
439 Q A -2.3611
440 G A -1.4674
441 A A -0.8242
442 S A -0.9026
443 G A -1.1055
444 P A -0.8298
445 A A -0.9806
446 G A -1.6730
447 P A -1.2127
448 S A -1.5931
449 G A -2.0123
450 P A -1.7505
451 R A -2.3449
452 G A -1.1851
453 P A -0.7260
454 P A -0.0453
455 G A 0.5186
456 P A 0.5623
457 V A 1.6706
458 G A 0.7815
459 P A -0.1752
460 S A -1.0523
461 G A -1.9901
462 K A -3.0269
463 D A -3.0850
464 G A -2.2285
465 A A -1.5075
466 N A -1.5409
467 G A 0.0319
468 I A 1.6867
469 P A 1.1280
470 G A 1.0881
471 P A 0.9528
472 I A 1.5089
473 G A 0.1013
474 P A -0.4178
475 P A -1.1257
476 G A -1.8028
477 P A -1.9747
478 R A -2.7403
479 G A -2.2926
480 R A -2.8938
481 S A -2.0746
482 G A -1.8793
483 E A -2.4194
484 T A -1.2628
485 G A -1.0777
486 P A -0.8421
487 A A -0.9809
488 G A -1.5386
489 P A -1.3119
490 P A -1.3021
491 G A -1.7157
492 N A -1.8582
493 P A -1.3376
494 G A -1.1968
495 P A -0.9497
496 P A -0.5683
497 G A -0.4453
498 P A -0.5352
499 P A -0.4676
500 G A -0.4448
501 P A -0.6770
502 P A -0.7192
503 G A -0.2244
504 P A -0.3299
505 G A -0.1382
506 I A 1.0276
507 D A -0.2143
508 M A 1.2235
509 S A 0.5738
510 A A 1.1464
511 F A 2.1888
512 A A 1.1261
513 G A 0.8385
514 L A 1.2474
515 G A -0.4529
516 P A -1.7799
517 R A -3.1986
518 E A -3.7925
519 K A -3.5293
520 G A -2.3876
521 P A -1.7472
522 D A -1.6096
523 P A -0.1923
524 L A 0.7796
525 Q A -0.4111
526 Y A 0.9677
527 M A 0.8400
528 R A -0.9838
529 A A -0.4478
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.3874 5.7655 View CSV PDB
4.5 0.3305 5.7655 View CSV PDB
5.0 0.2621 5.7655 View CSV PDB
5.5 0.1929 5.7655 View CSV PDB
6.0 0.1341 5.7655 View CSV PDB
6.5 0.094 5.7655 View CSV PDB
7.0 0.0732 5.7655 View CSV PDB
7.5 0.0658 5.7655 View CSV PDB
8.0 0.0664 5.7655 View CSV PDB
8.5 0.0743 5.7655 View CSV PDB
9.0 0.0908 5.7655 View CSV PDB