Project name: f133145e0aac29a [mutate: AS56B]

Status: done

Started: 2026-02-20 09:43:48
Chain sequence(s) A: DIVMTQSHKFMSTSVGDRVSITCKASQDIYNYVHWYQEKPGQCPKLLIYGASNRYTGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQSVFFSSTFGGGTKLEIK
B: EVQLVESGGGLVKPGGSLKVSCAASGFTLTSYVLSWVRQTPEKRLEWVATINEVGAYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARVTFVAFDVWGAGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues AS56B
Energy difference between WT (input) and mutated protein (by FoldX) 0.403252 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:16)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7e06567235d8426/tmp/folded.pdb                (00:01:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:53)
Show buried residues

Minimal score value
-3.0282
Maximal score value
3.1145
Average score
-0.4874
Total score value
-109.1852

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.7779
2 I A -0.1242
3 V A 1.1235
4 M A 0.0000
5 T A -0.5178
6 Q A -1.2195
7 S A -0.8826
8 H A -1.2620
9 K A -1.4448
10 F A 0.4011
11 M A -0.0069
12 S A -0.3159
13 T A -0.9007
14 S A -1.0033
15 V A -0.3542
16 G A -1.3619
17 D A -2.1574
18 R A -2.5121
19 V A -1.2468
20 S A -0.5409
21 I A 0.0000
22 T A -0.8807
23 C A 0.0000
24 K A -1.5649
25 A A -0.7849
26 S A -0.6851
27 Q A -1.1497
28 D A -1.8558
29 I A 0.0000
30 Y A 0.0271
31 N A -0.5444
32 Y A 0.9135
33 V A 0.0000
34 H A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 E A -1.0400
39 K A -1.3667
40 P A -1.0814
41 G A -1.1949
42 Q A -1.5710
43 C A -0.5538
44 P A 0.0000
45 K A -1.0557
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.2885
50 G A 0.2737
51 A A 0.0000
52 S A -1.0788
53 N A -1.1184
54 R A -1.7788
55 Y A -0.6024
56 T A -0.5932
57 G A -0.8686
58 V A 0.0000
59 P A -1.3098
60 D A -2.2359
61 R A -1.8456
62 L A 0.0000
63 T A -0.9730
64 G A -0.6869
65 S A -0.9963
66 G A -1.3297
67 S A -1.2032
68 G A -1.1660
69 T A -1.8240
70 D A -2.3367
71 F A 0.0000
72 T A -0.8024
73 L A 0.0000
74 T A -0.5144
75 I A 0.0000
76 S A -1.9853
77 N A -2.2094
78 V A 0.0000
79 E A -1.6927
80 S A -1.3315
81 E A -1.8760
82 D A 0.0000
83 L A -0.7030
84 A A 0.0000
85 D A -0.9181
86 Y A 0.0000
87 F A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 S A 0.0000
92 V A 0.0000
93 F A 2.9789
94 F A 3.1145
95 S A 1.1775
96 S A 0.0000
97 T A -0.0442
98 F A 0.0000
99 G A 0.0000
100 G A -1.2202
101 G A 0.0000
102 T A 0.0000
103 K A -0.7357
104 L A 0.0000
105 E A -0.8511
106 I A -1.1542
107 K A -1.6010
1 E B -1.8016
2 V B -0.6633
3 Q B -0.8958
4 L B 0.0000
5 V B 1.0436
6 E B 0.3698
7 S B -0.4266
8 G B -1.0719
9 G B -0.5305
10 G B 0.2290
11 L B 1.1602
12 V B -0.2115
13 K B -1.8465
14 P B -1.9318
15 G B -1.5718
16 G B -1.2121
17 S B -1.2798
18 L B -1.0192
19 K B -2.0281
20 V B 0.0000
21 S B -0.3692
22 C B 0.0000
23 A B -0.0689
24 A B -0.3444
25 S B -0.6281
26 G B -0.9179
27 F B -0.3016
28 T B -0.4316
29 L B 0.0000
30 T B -0.1347
31 S B -0.0275
32 Y B 0.6872
33 V B 0.8109
34 L B 0.0000
35 S B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B 0.0000
40 T B -1.8454
41 P B -1.7391
42 E B -2.9421
43 K B -3.0282
44 R B -2.1678
45 L B 0.0000
46 E B -0.9243
47 W B 0.0000
48 V B 0.0000
49 A B 0.0000
50 T B 0.5799
51 I B 0.0000
52 N B 0.3875
53 E B 0.1584
54 V B 1.2789
55 G B 0.4617
56 S B 0.6550 mutated: AS56B
57 Y B 1.2995
58 T B 0.8458
59 Y B 0.7765
60 Y B -0.5300
61 P B 0.0000
62 D B -2.9286
63 S B -2.1063
64 V B 0.0000
65 K B -2.5591
66 G B -1.6683
67 R B -1.3133
68 F B 0.0000
69 T B -0.7156
70 I B 0.0000
71 S B -0.0639
72 R B -0.6401
73 D B -1.0748
74 N B -1.1817
75 A B -1.2228
76 K B -2.1414
77 N B -1.4960
78 T B -0.8139
79 L B 0.0000
80 Y B -0.3003
81 L B 0.0000
82 Q B -1.2209
83 M B 0.0000
84 S B -1.1074
85 S B -1.1951
86 L B 0.0000
87 R B -2.8649
88 S B -2.2357
89 E B -2.5147
90 D B 0.0000
91 T B -0.7225
92 A B 0.0000
93 M B -0.0795
94 Y B 0.0000
95 Y B 0.2990
96 C B 0.0000
97 A B 0.0000
98 R B 0.0000
99 V B 1.2491
100 T B 1.6205
101 F B 2.7819
102 V B 2.9159
103 A B 0.0000
104 F B 0.0000
105 D B 0.2842
106 V B -0.0213
107 W B 0.0000
108 G B 0.0000
109 A B 0.1021
110 G B 0.2396
111 T B -0.0782
112 T B 0.0439
113 V B 0.0000
114 T B -0.1565
115 V B 0.0000
116 S B -1.0322
117 S B -0.8729
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4793 6.3709 View CSV PDB
4.5 -0.5257 6.3709 View CSV PDB
5.0 -0.5808 6.3709 View CSV PDB
5.5 -0.6324 6.3709 View CSV PDB
6.0 -0.6686 6.3709 View CSV PDB
6.5 -0.6827 6.3709 View CSV PDB
7.0 -0.6765 6.3709 View CSV PDB
7.5 -0.657 6.3709 View CSV PDB
8.0 -0.6302 6.3709 View CSV PDB
8.5 -0.5976 6.3708 View CSV PDB
9.0 -0.5581 6.3706 View CSV PDB