Project name: 7e27f0494c9ba96

Status: done

Started: 2026-08-17 04:56:06
Chain sequence(s) A: TNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQPESRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGWSMGGGGSLISAANNPSLKAAAPQAPWHSSTNFSSVTVPTLIFACENDSIAPVNSSALPIYDSMSQNAKQFLEIKGGSHSCANSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTAVSDFRTANC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7e27f0494c9ba96/tmp/folded.pdb                (00:03:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:52)
Show buried residues

Minimal score value
-2.3984
Maximal score value
1.7146
Average score
-0.4743
Total score value
-123.7864

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
29 T A -0.2592
30 N A -0.6230
31 P A -0.4409
32 Y A -0.2382
33 A A -0.7086
34 R A -0.6535
35 G A -0.9896
36 P A -1.1617
37 N A -1.6486
38 P A -0.8990
39 T A -0.5746
40 A A -0.2277
41 A A -0.3764
42 S A -0.6723
43 L A 0.0000
44 E A -1.1222
45 A A -0.6472
46 S A -0.5275
47 A A -0.2432
48 G A -0.3278
49 P A -0.3737
50 F A -0.4858
51 T A -0.5587
52 V A -0.8174
53 R A -1.7116
54 S A -0.8855
55 F A -0.2194
56 T A -0.2561
57 V A 0.0000
58 S A -1.1226
59 R A -2.1337
60 P A -1.4582
61 S A -1.3303
62 G A -1.3109
63 Y A 0.0000
64 G A -1.3796
65 A A -1.0032
66 G A 0.0000
67 T A -0.1483
68 V A 0.0000
69 Y A 0.0000
70 Y A -0.5961
71 P A 0.0000
72 T A -1.0735
73 N A -1.4173
74 A A -1.0096
75 G A -0.9716
76 G A -0.8665
77 T A -0.5986
78 V A 0.0000
79 G A 0.0000
80 A A 0.0000
81 I A 0.0000
82 A A 0.0000
83 I A 0.0000
84 V A 0.0000
85 P A 0.0000
86 G A 0.0000
87 Y A 0.7675
88 T A 0.3003
89 A A -0.4717
90 R A -1.8978
91 Q A -1.3753
92 S A -1.2390
93 S A -1.0031
94 I A 0.0000
95 K A -1.3901
96 W A -0.6659
97 W A 0.0000
98 G A 0.0000
99 P A -0.5185
100 R A 0.0000
101 L A 0.0000
102 A A 0.0000
103 S A 0.0000
104 H A 0.0000
105 G A 0.0000
106 F A 0.0000
107 V A 0.0000
108 V A 0.0000
109 I A 0.0000
110 T A 0.0000
111 I A 0.0000
112 D A 0.0000
113 T A 0.0000
114 N A -1.3643
115 S A -0.5878
116 T A -0.0742
117 L A 0.9185
118 D A -0.5610
119 Q A -1.3754
120 P A 0.0000
121 E A -2.2624
122 S A -1.4580
123 R A 0.0000
124 S A 0.0000
125 S A -0.6772
126 Q A 0.0000
127 Q A 0.0000
128 M A -0.4968
129 A A -0.8757
130 A A 0.0000
131 L A 0.0000
132 R A -1.9875
133 Q A -1.4290
134 V A 0.0000
135 A A -0.9077
136 S A -0.7259
137 L A -0.3332
138 N A -0.4883
139 G A -0.4740
140 T A -0.1886
141 S A -0.1696
142 S A -0.1630
143 S A -0.0063
144 P A -0.1995
145 I A 0.0000
146 Y A 0.4708
147 G A -0.3998
148 K A -0.7191
149 V A 0.0000
150 D A -0.4901
151 T A -0.5992
152 A A -0.1083
153 R A 0.0000
154 M A -0.0178
155 G A 0.0000
156 V A 0.0000
157 M A 0.0000
158 G A 0.0000
159 W A 0.2894
160 S A 0.0000
161 M A 0.0000
162 G A 0.0000
163 G A 0.0000
164 G A 0.0000
165 G A 0.0000
166 S A 0.0000
167 L A 0.0000
168 I A -0.6390
169 S A 0.0000
170 A A 0.0000
171 A A -0.8133
172 N A -1.5133
173 N A -1.1709
174 P A -0.9728
175 S A -0.6867
176 L A 0.0000
177 K A -0.5673
178 A A 0.0000
179 A A 0.0000
180 A A 0.0000
181 P A 0.0000
182 Q A 0.0000
183 A A 0.0000
184 P A 0.0000
185 W A 0.5610
186 H A -0.5869
187 S A -0.5266
188 S A -0.6296
189 T A -0.9980
190 N A -1.6965
191 F A 0.0000
192 S A -1.1644
193 S A -0.9196
194 V A 0.0000
195 T A -0.7180
196 V A 0.0000
197 P A -0.3895
198 T A 0.0000
199 L A 0.0000
200 I A 0.0000
201 F A 0.0000
202 A A 0.0000
203 C A 0.0000
204 E A -2.2306
205 N A -1.9324
206 D A 0.0000
207 S A 0.2381
208 I A 1.7146
209 A A 0.0000
210 P A -0.4095
211 V A 0.0000
212 N A -1.4405
213 S A -0.8066
214 S A 0.0000
215 A A 0.0000
216 L A -0.8844
217 P A -1.2253
218 I A 0.0000
219 Y A 0.0000
220 D A -2.0896
221 S A -1.5614
222 M A 0.0000
223 S A -1.3776
224 Q A -1.5759
225 N A 0.0000
226 A A -0.6223
227 K A 0.0000
228 Q A 0.0000
229 F A 0.0000
230 L A 0.0000
231 E A 0.0000
232 I A 0.0000
233 K A -2.3984
234 G A -1.9260
235 G A 0.0000
236 S A -0.9482
237 H A -0.1908
238 S A -0.0734
239 C A -0.8440
240 A A 0.0000
241 N A 0.0000
242 S A -0.7443
243 G A -0.8610
244 N A -0.6846
245 S A -0.6388
246 N A -0.7667
247 Q A -0.9479
248 A A -0.7752
249 L A -0.3890
250 I A 0.0000
251 G A 0.0000
252 K A -0.5303
253 K A 0.0000
254 G A 0.0000
255 V A 0.0000
256 A A 0.0000
257 W A 0.0000
258 M A 0.0000
259 K A 0.0000
260 R A -0.6822
261 F A -0.4598
262 M A 0.0000
263 D A 0.0000
264 N A -1.2907
265 D A 0.0000
266 T A -0.7547
267 R A -1.1220
268 Y A 0.0000
269 S A -0.5695
270 T A -0.6478
271 F A -0.4662
272 A A 0.0000
273 C A -0.9721
274 E A -2.1298
275 N A -1.8427
276 P A -1.2938
277 N A -1.7367
278 S A -0.9139
279 T A -0.6248
280 A A -0.8326
281 V A -0.9180
282 S A -1.1118
283 D A -0.8671
284 F A -0.6960
285 R A -1.1128
286 T A -0.8246
287 A A -0.7873
288 N A -1.2753
289 C A -0.4768
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3912 2.4269 View CSV PDB
4.5 -0.4069 2.434 View CSV PDB
5.0 -0.4264 2.4402 View CSV PDB
5.5 -0.4464 2.4436 View CSV PDB
6.0 -0.4627 2.4449 View CSV PDB
6.5 -0.4724 2.4454 View CSV PDB
7.0 -0.4751 2.4456 View CSV PDB
7.5 -0.4727 2.4456 View CSV PDB
8.0 -0.4674 2.4456 View CSV PDB
8.5 -0.4601 2.4456 View CSV PDB
9.0 -0.4509 2.4457 View CSV PDB