Project name: VAAA_R1

Status: done

Started: 2026-08-21 04:37:47
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7e859e08e88dfd8/tmp/folded.pdb                (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-2.7471
Maximal score value
1.9473
Average score
-0.5473
Total score value
-135.7397

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5668
2 V A -1.2257
3 Q A -1.9260
4 L A 0.0000
5 Q A -1.8374
6 E A 0.0000
7 S A -0.6881
8 G A -0.4093
9 P A -0.0424
10 G A 0.2574
11 L A 0.7389
12 V A 0.0000
13 K A -1.7227
14 P A -1.3039
15 S A -1.3960
16 Q A -1.9224
17 T A -1.4982
18 L A 0.0000
19 S A -0.8081
20 L A 0.0000
21 T A -0.5595
22 V A 0.0000
23 T A -1.2144
24 V A 0.0000
25 S A -1.2252
26 G A -1.2756
27 G A -0.9746
28 S A -0.7100
29 I A 0.0000
30 S A -0.2953
31 S A -0.3518
32 G A -0.1057
33 D A -0.0187
34 Y A 0.6284
35 Y A 0.6039
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6941
43 P A -0.6641
44 G A -1.1253
45 C A -1.2281
46 K A -2.0206
47 G A -1.2071
48 L A 0.0000
49 E A -0.7531
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1539
54 I A 0.0000
55 Y A 0.2973
56 Y A 0.2666
57 S A -0.1145
58 G A -0.2497
59 S A -0.2661
60 T A -0.2570
61 D A -0.7207
62 Y A -0.7220
63 N A -0.9629
64 P A -1.2874
65 S A -1.0750
66 L A 0.0000
67 K A -2.0949
68 S A -1.4027
69 R A -1.5650
70 V A 0.0000
71 T A -0.9705
72 M A 0.0000
73 S A -0.2921
74 V A -0.3503
75 D A -1.1848
76 T A -1.0490
77 S A -1.3422
78 K A -2.1726
79 N A -1.4375
80 Q A -1.2573
81 F A 0.0000
82 S A -0.4206
83 L A 0.0000
84 K A -1.2020
85 V A 0.0000
86 N A -1.6302
87 S A -1.4653
88 V A 0.0000
89 T A -0.6584
90 A A -0.2315
91 A A 0.0092
92 D A 0.0000
93 T A 0.2473
94 A A 0.0000
95 V A 0.2561
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7423
103 I A 1.4984
104 F A 1.9473
105 G A 0.6794
106 V A 0.5168
107 G A 0.6199
108 T A 0.0000
109 F A 0.0000
110 D A -0.5219
111 Y A -0.5226
112 W A -0.7721
113 G A 0.0000
114 Q A -1.6168
115 G A -0.7292
116 T A -0.1605
117 L A 0.8478
118 V A 0.0000
119 T A 0.2920
120 V A 0.0000
121 S A -0.3584
122 S A -0.5853
123 A A -0.4946
124 A A -0.3472
125 G A -0.8346
126 G A -1.0731
127 G A -1.1204
128 G A -1.1602
129 S A -0.9469
130 G A -1.1860
131 G A -1.2154
132 G A -1.1407
133 G A -1.1990
134 S A -1.0222
135 G A -1.2519
136 G A -1.4261
137 G A -1.2499
138 G A -1.2405
139 S A -1.1054
140 D A -1.1008
141 I A -0.1913
142 V A 0.9387
143 M A 0.0000
144 T A -0.5930
145 Q A -0.6880
146 S A -0.7344
147 P A -0.3236
148 A A -0.3303
149 T A -0.4183
150 L A -0.1752
151 S A -0.3425
152 L A -0.7001
153 S A -1.0303
154 P A -1.5429
155 G A -1.8483
156 E A -2.4516
157 R A -2.7471
158 A A 0.0000
159 T A -0.6527
160 L A 0.0000
161 S A -0.8967
162 A A 0.0000
163 R A -2.3434
164 A A 0.0000
165 S A -0.9035
166 Q A -1.6021
167 S A -1.2162
168 V A 0.0000
169 S A -0.4563
170 S A -0.2706
171 Y A 0.7407
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.6381
179 P A -1.0529
180 G A -1.0124
181 C A -1.1522
182 Q A -1.5827
183 A A -1.1778
184 P A 0.0000
185 R A -1.4480
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5538
190 D A -0.6841
191 A A 0.0000
192 S A -1.1890
193 N A -1.7654
194 R A -1.6757
195 A A -1.0148
196 T A -0.6075
197 G A -0.5692
198 I A -0.5246
199 P A -0.3657
200 A A -0.3620
201 R A -0.7389
202 F A 0.0000
203 S A -0.7655
204 G A -0.8345
205 S A -0.8973
206 G A -1.1772
207 S A -0.9687
208 G A -1.0620
209 T A -1.7679
210 D A -2.1751
211 F A 0.0000
212 T A -0.7893
213 L A 0.0000
214 T A -0.6260
215 I A 0.0000
216 S A -1.4986
217 S A -1.8269
218 L A 0.0000
219 E A -2.2788
220 P A -1.5068
221 E A -2.3843
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.6346
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.2961
232 G A 0.0483
233 S A -0.2106
234 T A -0.4120
235 P A -0.4641
236 L A 0.0000
237 T A 0.1469
238 F A 0.2624
239 G A 0.0000
240 G A -0.7922
241 G A -0.7284
242 T A 0.0000
243 K A -0.8082
244 A A 0.0000
245 E A -0.4838
246 I A 0.6692
247 K A -0.8930
248 A A -0.3518
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4956 4.9282 View CSV PDB
4.5 -0.5168 4.9254 View CSV PDB
5.0 -0.5408 4.9175 View CSV PDB
5.5 -0.5622 4.8986 View CSV PDB
6.0 -0.5752 4.8643 View CSV PDB
6.5 -0.5755 4.8174 View CSV PDB
7.0 -0.5638 4.7643 View CSV PDB
7.5 -0.5444 4.7087 View CSV PDB
8.0 -0.5206 4.6523 View CSV PDB
8.5 -0.4936 4.5958 View CSV PDB
9.0 -0.4637 4.5394 View CSV PDB