Project name: 7edd003c35bb806

Status: done

Started: 2026-07-17 12:01:48
Chain sequence(s) B: QLQLVESGGGLVQAGDSLKLSCIDSGSTFNLYAMGWFRQAPGKEREFVASISRGGGSSYYADSQLKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNARAGRYDYWGQGTQVTVSSAAGH
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:16)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/7edd003c35bb806/tmp/folded.pdb                (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:46)
Show buried residues

Minimal score value
-3.4685
Maximal score value
1.1562
Average score
-0.8873
Total score value
-107.3655

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q B -1.3683
2 L B -0.8695
3 Q B -1.0362
4 L B 0.0000
5 V B 1.1562
6 E B 0.0000
7 S B -0.3432
8 G B -1.1724
9 G B -0.7998
10 G B 0.1132
11 L B 1.0410
12 V B 0.0000
13 Q B -1.6623
14 A B -1.8260
15 G B -1.9093
16 D B -2.1222
17 S B -1.6540
18 L B -1.0705
19 K B -1.8468
20 L B 0.0000
21 S B -0.1617
22 C B 0.0000
23 I B 0.4779
24 D B 0.0000
25 S B -0.6363
26 G B -0.8696
27 S B -0.9214
28 T B -0.6344
29 F B 0.0000
30 N B -1.8119
31 L B -0.5911
32 Y B 0.0000
33 A B -1.3912
34 M B 0.0000
35 G B 0.0000
36 W B 0.0000
37 F B 0.0729
38 R B 0.0000
39 Q B -1.9152
40 A B -1.9117
41 P B -1.3632
42 G B -1.9471
43 K B -3.3406
44 E B -3.4685
45 R B -2.4553
46 E B -1.9686
47 F B -0.2075
48 V B 0.0000
49 A B 0.0000
50 S B 0.3334
51 I B 0.0000
52 S B -1.2955
53 R B -2.4576
54 G B -1.9037
55 G B -1.6167
56 G B -1.1013
57 S B -0.5030
58 S B 0.1800
59 Y B 0.9330
60 Y B -0.3131
61 A B -0.8206
62 D B -2.1285
63 S B -2.3043
64 Q B -2.4740
65 L B 0.0000
66 K B -2.6003
67 G B -2.1796
68 R B -1.5993
69 F B 0.0000
70 T B -0.7487
71 I B 0.0000
72 S B -0.5574
73 R B -1.3863
74 D B -1.7345
75 N B -2.0292
76 A B -1.4459
77 K B -2.0589
78 N B -1.4960
79 T B 0.0000
80 V B 0.0000
81 Y B -0.4156
82 L B 0.0000
83 Q B -1.0397
84 M B 0.0000
85 N B -1.6331
86 S B -1.6394
87 L B 0.0000
88 K B -2.7172
89 P B -1.9550
90 E B -2.3623
91 D B 0.0000
92 T B -0.9768
93 A B 0.0000
94 V B -0.3572
95 Y B 0.0000
96 Y B -0.0441
97 C B 0.0000
98 N B 0.0000
99 A B 0.0000
100 R B -1.9734
101 A B -1.5234
102 G B -1.5672
103 R B -2.3163
104 Y B -1.4860
105 D B -1.6351
106 Y B -0.6637
107 W B -0.1267
108 G B -0.0518
109 Q B -0.9937
110 G B -0.4619
111 T B -0.6797
112 Q B -1.0969
113 V B 0.0000
114 T B -0.3258
115 V B 0.0000
116 S B -0.9446
117 S B -1.0172
118 A B -0.6636
119 A B -0.5423
120 G B -1.1041
121 H B -1.3291
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8388 1.6407 View CSV PDB
4.5 -0.8821 1.6407 View CSV PDB
5.0 -0.9309 1.6407 View CSV PDB
5.5 -0.9743 1.6407 View CSV PDB
6.0 -1.0003 1.6407 View CSV PDB
6.5 -1.0023 1.6407 View CSV PDB
7.0 -0.984 1.6407 View CSV PDB
7.5 -0.9547 1.6407 View CSV PDB
8.0 -0.9199 1.6407 View CSV PDB
8.5 -0.8803 1.6407 View CSV PDB
9.0 -0.835 1.6407 View CSV PDB