Project name: HS_SC

Status: done

Started: 2026-03-27 01:10:01
Chain sequence(s) A: EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISNGGRYTYYRDSAKGRFTISRDNAKNALYLEMSSLRSEDTAIYFCAKLGRGDFFDYWGQGTTLTVSS
B: DIQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYHAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYNSPRTFGGGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:00)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:19)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:28:43)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:28:44)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:28:44)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:28:45)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:28:46)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:28:47)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:28:47)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:28:48)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:28:49)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:28:50)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:28:50)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:28:51)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:28:52)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:28:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:28:56)
Show buried residues

Minimal score value
-3.5224
Maximal score value
2.1298
Average score
-0.7057
Total score value
-159.4895

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7817
2 V A 0.0000
3 Q A -1.1766
4 L A 0.0000
5 V A 0.4196
6 E A -0.3468
7 S A -0.6225
8 G A -0.8634
9 G A -0.7069
10 D A -0.6074
11 L A 0.4107
12 V A 0.0000
13 K A -1.8336
14 P A -1.4167
15 G A -1.1836
16 G A -1.1358
17 S A -1.3075
18 L A 0.0000
19 K A -1.5998
20 L A 0.0000
21 S A -0.5733
22 C A 0.0000
23 A A -0.3370
24 A A 0.0000
25 S A -0.8586
26 G A -0.8124
27 F A 0.2112
28 T A -0.2295
29 F A 0.0000
30 S A -0.8283
31 S A -0.4334
32 Y A 0.0000
33 G A 0.0000
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A 0.0000
41 P A -2.4282
42 D A -3.5224
43 K A -3.1703
44 R A -2.7700
45 L A 0.0000
46 E A -0.9481
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.0000
51 I A 0.0000
52 S A -0.5356
53 N A -1.1785
54 G A -1.2182
55 G A -1.2897
56 R A -1.7001
57 Y A 0.2336
58 T A 0.3955
59 Y A 0.0000
60 Y A 0.4096
61 R A -1.2565
62 D A -2.0714
63 S A -1.1474
64 A A -0.8147
65 K A 0.0000
66 G A -1.6252
67 R A -2.0305
68 F A -0.9667
69 T A -0.5396
70 I A -0.1361
71 S A -0.4288
72 R A -1.2733
73 D A -2.0732
74 N A -1.9320
75 A A -1.5065
76 K A -2.3912
77 N A -1.6451
78 A A -1.0479
79 L A 0.0000
80 Y A -0.3038
81 L A 0.0000
82 E A -1.2797
83 M A 0.0000
84 S A -1.7805
85 S A -1.6345
86 L A 0.0000
87 R A -2.5459
88 S A -2.8127
89 E A -3.4025
90 D A -3.1952
91 T A -1.5747
92 A A 0.0000
93 I A -0.0460
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 A A 0.0000
98 K A 0.0000
99 L A -0.8620
100 G A -1.5632
101 R A -2.4488
102 G A -2.2718
103 D A -2.4267
104 F A 0.0000
105 F A 0.0000
106 D A 0.0000
107 Y A 0.0347
108 W A 0.0000
109 G A 0.0000
110 Q A -0.7275
111 G A -0.5785
112 T A 0.0000
113 T A -0.1498
114 L A 0.0000
115 T A -0.8542
116 V A 0.0000
117 S A -1.4927
118 S A -1.6806
1 D B -2.7200
2 I B 0.0000
3 Q B -2.1167
4 M B -1.3172
5 T B -1.1779
6 Q B -0.9170
7 S B -0.8590
8 P B -0.4518
9 A B -0.3993
10 S B -0.8072
11 L B -0.7284
12 S B -1.1909
13 A B 0.0000
14 S B -1.1979
15 V B 0.2105
16 G B -0.5964
17 E B -1.6597
18 T B -0.7745
19 V B 0.0000
20 T B -0.6983
21 I B 0.0000
22 T B 0.0000
23 C B 0.0000
24 R B -2.6284
25 A B 0.0000
26 S B -1.3620
27 E B -0.7858
28 N B -0.4588
29 I B 2.1298
30 Y B 1.9830
31 S B 0.8143
32 Y B 0.5128
33 L B 0.0000
34 A B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.8560
40 Q B -2.0452
41 G B -1.7829
42 K B -1.9592
43 S B -0.9500
44 P B 0.0000
45 Q B -0.1420
46 L B 0.0000
47 L B 0.0000
48 V B 0.0000
49 Y B -0.4380
50 H B -0.8229
51 A B -0.6142
52 K B -0.5979
53 T B 0.0792
54 L B 0.8774
55 A B 0.3945
56 E B 0.1201
57 G B 0.3412
58 V B 0.4532
59 P B -0.1287
60 S B -0.7274
61 R B -1.7745
62 F B -1.0358
63 S B -0.7403
64 G B -0.6581
65 S B -0.9501
66 G B -1.1874
67 S B -1.1639
68 G B -1.0542
69 T B -1.0732
70 Q B -1.9655
71 F B 0.0000
72 S B -1.1500
73 L B 0.0000
74 K B -1.3113
75 I B 0.0000
76 N B -1.0386
77 S B -1.1125
78 L B 0.0000
79 Q B -1.0558
80 P B -1.3008
81 E B -2.5319
82 D B -2.4146
83 F B 0.0000
84 G B -1.4718
85 S B 0.0000
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 H B 0.0000
91 H B -0.3294
92 Y B 0.1437
93 N B -0.4307
94 S B -0.6305
95 P B -1.2019
96 R B 0.0000
97 T B 0.0000
98 F B -0.5195
99 G B 0.0000
100 G B 0.0000
101 G B -1.5362
102 T B 0.0000
103 K B -1.4515
104 L B 0.0000
105 E B -2.3576
106 I B -1.9719
107 K B -2.8083
108 R B -2.5914
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.7057 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_5 -0.7057 View CSV PDB
input -0.7372 View CSV PDB
model_10 -0.7418 View CSV PDB
model_0 -0.7559 View CSV PDB
model_6 -0.7578 View CSV PDB
model_9 -0.7696 View CSV PDB
model_8 -0.7779 View CSV PDB
CABS_average -0.7857 View CSV PDB
model_4 -0.8021 View CSV PDB
model_1 -0.8161 View CSV PDB
model_2 -0.8208 View CSV PDB
model_11 -0.8239 View CSV PDB
model_3 -0.8261 View CSV PDB
model_7 -0.8303 View CSV PDB