Project name: ok 15

Status: done

Started: 2026-03-17 06:59:28
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASQSVSYMNWYKQKPGLAPRLLIYDTSNLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSNNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:11)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:13)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:13)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/818e10ba9a12e09/tmp/folded.pdb                (00:04:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:58)
Show buried residues

Minimal score value
-3.6531
Maximal score value
1.1456
Average score
-0.7353
Total score value
-175.738

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9965
2 I A 0.0000
3 V A 0.8959
4 L A 0.0000
5 T A -0.2797
6 K A -0.5490
7 S A -0.5062
8 P A -0.4040
9 A A -0.5701
10 T A -0.4856
11 L A -0.4065
12 S A -0.8144
13 L A -1.1103
14 S A -1.6851
15 P A -2.0785
16 G A -2.4476
17 E A -3.0087
18 R A -3.3045
19 A A 0.0000
20 T A -0.5231
21 L A 0.0000
22 S A -0.7020
23 C A 0.0000
24 S A -0.9608
25 A A 0.0000
26 S A -0.7150
27 Q A -1.6628
28 S A -1.3882
29 V A 0.0000
30 S A -0.6140
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.3300
37 Q A 0.0000
38 K A -0.7734
39 P A -0.3523
40 G A -0.3044
41 L A 0.1394
42 A A -0.1955
43 P A 0.0000
44 R A -0.5018
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.0754
49 D A -0.8218
50 T A -0.5649
51 S A -0.6270
52 N A -0.5168
53 L A -0.1364
54 A A 0.0000
55 T A -0.1391
56 G A -0.5827
57 I A -0.4457
58 P A -0.9479
59 D A -1.8698
60 R A -1.8975
61 F A 0.0000
62 S A -0.6967
63 G A -0.4657
64 S A -0.9329
65 G A -1.1754
66 S A -1.0982
67 G A -1.2172
68 T A -1.5779
69 D A -2.2683
70 F A 0.0000
71 T A -0.7497
72 L A 0.0000
73 T A -0.8073
74 I A 0.0000
75 S A -2.4550
76 R A -3.4335
77 L A 0.0000
78 E A -2.6573
79 P A -1.8340
80 E A -2.4918
81 D A 0.0000
82 F A -0.9742
83 A A 0.0000
84 V A -0.5380
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.3237
91 S A -0.6605
92 N A -2.0189
93 N A -2.1317
94 P A -1.8025
95 F A 0.0000
96 T A 0.0000
97 F A 0.2271
98 G A 0.0000
99 Q A -1.2599
100 G A 0.0000
101 T A 0.0000
102 K A -1.2226
103 L A 0.0000
104 E A -1.1618
105 I A -1.1387
106 K A -2.0227
107 G A -1.5477
108 G A -1.3857
109 G A -1.2657
110 G A -1.5036
111 S A -1.1836
112 G A -1.5539
113 G A -1.6223
114 G A -1.3598
115 G A -1.4251
116 S A -1.0006
117 G A -1.2741
118 G A -1.3116
119 G A -1.3171
120 G A -1.3462
121 S A -1.2980
122 Q A -1.8043
123 V A -0.9701
124 Q A -1.3767
125 L A 0.0000
126 V A -0.1447
127 Q A 0.0000
128 S A -0.5850
129 G A -0.6169
130 A A 0.0136
131 E A 0.1003
132 V A 0.9932
133 Q A -0.7337
134 K A -2.0156
135 P A -1.9977
136 G A -1.4244
137 A A -1.1367
138 S A -1.1744
139 V A 0.0000
140 K A -1.4480
141 V A 0.0000
142 S A -0.5753
143 C A 0.0000
144 K A -1.0920
145 A A 0.0000
146 S A -0.8635
147 G A -1.0399
148 Y A -0.7122
149 T A -0.7878
150 F A 0.0000
151 N A -2.0957
152 R A -2.3765
153 Y A -1.2352
154 T A -0.6120
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.2306
161 A A -0.6778
162 P A -0.7317
163 G A -1.1022
164 Q A -1.0006
165 L A 0.0000
166 L A -0.1112
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.3683
171 I A 0.0000
172 N A -0.6132
173 P A 0.0000
174 S A -1.6694
175 R A -1.5828
176 G A -0.2885
177 Y A 1.0124
178 Y A 1.1456
179 N A -0.5653
180 Y A -1.4867
181 A A -2.0654
182 Q A -2.9745
183 K A -3.0148
184 F A 0.0000
185 K A -3.6531
186 D A -3.2659
187 R A -2.1507
188 V A 0.0000
189 T A -0.9654
190 M A 0.0000
191 T A -0.2120
192 R A -1.3080
193 D A -1.1306
194 T A -0.8526
195 S A -0.5536
196 T A -0.6780
197 S A -0.8873
198 T A 0.0000
199 V A 0.0000
200 Y A -0.6489
201 M A 0.0000
202 E A -1.2582
203 L A 0.0000
204 S A -1.1748
205 S A -1.2051
206 L A 0.0000
207 R A -2.5130
208 S A -2.1053
209 E A -2.3607
210 D A 0.0000
211 T A -0.7681
212 A A -0.2799
213 V A 0.1144
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.0607
221 D A -2.4180
222 D A -2.4906
223 H A -1.3444
224 Y A -0.3240
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.1073
229 W A -0.1060
230 G A 0.0000
231 Q A -0.9491
232 G A -0.3731
233 T A 0.0000
234 T A 0.0411
235 V A 0.0000
236 T A -0.2131
237 V A 0.0000
238 S A -0.7776
239 S A -0.9151
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6936 1.9849 View CSV PDB
4.5 -0.7365 1.9885 View CSV PDB
5.0 -0.7859 1.9977 View CSV PDB
5.5 -0.8336 2.0166 View CSV PDB
6.0 -0.8716 2.0451 View CSV PDB
6.5 -0.8944 2.0792 View CSV PDB
7.0 -0.9012 2.1157 View CSV PDB
7.5 -0.8965 2.153 View CSV PDB
8.0 -0.8843 2.1903 View CSV PDB
8.5 -0.8651 2.2271 View CSV PDB
9.0 -0.8381 2.262 View CSV PDB