Project name: asyn_A53T_full_c0433

Status: done

Started: 2026-07-29 12:45:48
Chain sequence(s) A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/825b3431277daf2/tmp/folded.pdb                (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-3.6819
Maximal score value
3.197
Average score
-0.8083
Total score value
-113.1614

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.0106
2 D A 0.1531
3 V A 1.8603
4 F A 1.9765
5 M A 0.4409
6 K A -0.7940
7 G A -0.8736
8 L A -0.4006
9 S A -1.1820
10 K A -2.1480
11 A A -1.4490
12 K A -2.3367
13 E A -2.0104
14 G A -1.1414
15 V A 1.6268
16 V A 1.8635
17 A A 1.2344
18 A A 0.0856
19 A A -1.1127
20 E A -2.5183
21 K A -2.8450
22 T A -2.4217
23 K A -2.3191
24 Q A -1.5472
25 G A -0.6082
26 V A 0.5846
27 A A -0.5971
28 E A -1.4779
29 A A -0.9201
30 A A -0.4303
31 G A -0.7023
32 K A -1.3969
33 T A -1.9679
34 K A -2.4192
35 E A -3.0334
36 G A -1.3834
37 V A -0.0345
38 L A 1.3184
39 Y A 2.0299
40 V A 1.8704
41 G A 0.2896
42 S A -0.3807
43 K A -0.4480
44 T A -0.4492
45 K A -0.4296
46 E A -2.2594
47 G A -2.5972
48 V A -1.5970
49 V A -2.1865
50 H A -1.7059
51 G A -0.7018
52 V A 1.1839
53 T A 1.0830
54 T A 0.7012
55 V A 1.2029
56 A A -0.3942
57 E A -2.3026
58 K A -3.1546
59 T A -2.8852
60 K A -3.6045
61 E A -3.0635
62 Q A -1.8431
63 V A 0.5856
64 T A 0.0119
65 N A -0.2943
66 V A 0.6641
67 G A -0.5985
68 G A 0.2562
69 A A 2.0631
70 V A 3.1970
71 V A 3.0172
72 T A 1.5561
73 G A 1.7282
74 V A 3.0493
75 T A 2.1684
76 A A 1.6388
77 V A 2.1693
78 A A -0.0405
79 Q A -1.4455
80 K A -1.5905
81 T A -0.6211
82 V A 0.0796
83 E A -1.2358
84 G A -1.0034
85 A A -0.1428
86 G A -0.2560
87 S A 0.4745
88 I A 1.8307
89 A A 0.9906
90 A A 0.4880
91 A A 0.0962
92 T A -0.0512
93 G A 0.7178
94 F A 1.9728
95 V A 0.9589
96 K A -2.0268
97 K A -3.6209
98 D A -3.2894
99 Q A -2.4964
100 L A -1.4105
101 G A -2.2886
102 K A -2.8500
103 N A -3.3595
104 E A -3.6811
105 E A -3.4236
106 G A -2.2378
107 A A -1.7352
108 P A -1.5090
109 Q A -2.2804
110 E A -2.2930
111 G A -1.2813
112 I A -0.0278
113 L A 0.4275
114 E A -2.0433
115 D A -1.4545
116 M A -0.2422
117 P A -0.1218
118 V A 0.5180
119 D A -1.4143
120 P A -1.8397
121 D A -3.1675
122 N A -3.0450
123 E A -2.5455
124 A A -0.8267
125 Y A 0.3616
126 E A -0.7737
127 M A 0.0829
128 P A -0.9713
129 S A -2.1120
130 E A -3.2819
131 E A -3.6819
132 G A -1.9099
133 Y A -1.0559
134 Q A -3.0692
135 D A -2.8518
136 Y A -1.9517
137 E A -3.2100
138 P A -2.0824
139 E A -2.3950
140 A A -1.5693
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.0665 4.1569 View CSV PDB
4.5 -0.2083 4.1253 View CSV PDB
5.0 -0.3893 4.0857 View CSV PDB
5.5 -0.5722 4.0537 View CSV PDB
6.0 -0.7166 4.0502 View CSV PDB
6.5 -0.7921 4.091 View CSV PDB
7.0 -0.7942 4.1726 View CSV PDB
7.5 -0.745 4.2784 View CSV PDB
8.0 -0.6693 4.3944 View CSV PDB
8.5 -0.5791 4.5136 View CSV PDB
9.0 -0.4764 4.633 View CSV PDB