Project name: ok 13

Status: done

Started: 2026-03-17 06:58:45
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASQSVSYMNWYKQKPGLAPRLLIYDTSNLAYGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:07)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:52)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/828096e04918e86/tmp/folded.pdb                (00:03:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:51)
Show buried residues

Minimal score value
-3.331
Maximal score value
1.1892
Average score
-0.7073
Total score value
-169.0431

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8565
2 I A 0.0000
3 V A 0.8789
4 L A 0.0000
5 T A -0.3009
6 K A -0.5810
7 S A -0.5178
8 P A -0.4284
9 A A -0.5599
10 T A -0.5468
11 L A -0.4701
12 S A -0.9337
13 L A -1.1319
14 S A -1.6020
15 P A -1.9284
16 G A -2.3540
17 E A -2.8379
18 R A -3.2211
19 A A 0.0000
20 T A -0.5383
21 L A 0.0000
22 S A -0.6964
23 C A 0.0000
24 S A -0.9559
25 A A 0.0000
26 S A -0.7050
27 Q A -1.5629
28 S A -1.2953
29 V A 0.0000
30 S A -0.5319
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.3333
37 Q A 0.0000
38 K A -0.5959
39 P A -0.3783
40 G A -0.3054
41 L A 0.1541
42 A A -0.1886
43 P A 0.0000
44 R A -0.4675
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.3629
49 D A -1.1288
50 T A -0.7960
51 S A -0.9225
52 N A -0.8720
53 L A -0.0700
54 A A 0.0000
55 Y A 1.1892
56 G A 0.0869
57 I A -0.0675
58 P A -0.7557
59 D A -1.8823
60 R A -1.9091
61 F A 0.0000
62 S A -0.7702
63 G A 0.0000
64 S A -1.0057
65 G A -1.2126
66 S A -1.1207
67 G A -1.2299
68 T A -1.5849
69 D A -2.2774
70 F A 0.0000
71 T A -0.7483
72 L A 0.0000
73 T A -0.7986
74 I A 0.0000
75 S A -2.4030
76 R A -3.3310
77 L A 0.0000
78 E A -2.3193
79 P A -1.6473
80 E A -2.2113
81 D A 0.0000
82 F A -0.9036
83 A A 0.0000
84 V A -0.5578
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.1128
91 S A -0.3280
92 S A -1.2458
93 N A -1.7555
94 P A -1.6053
95 F A 0.0000
96 T A 0.0000
97 F A 0.2096
98 G A 0.0000
99 Q A -1.2988
100 G A 0.0000
101 T A 0.0000
102 K A -1.2224
103 L A 0.0000
104 E A -1.2032
105 I A -1.0806
106 K A -2.0060
107 G A -1.5336
108 G A -1.3549
109 G A -1.2753
110 G A -1.3222
111 S A -1.0136
112 G A -1.5227
113 G A -1.5280
114 G A -1.3757
115 G A -1.4275
116 S A -1.0221
117 G A -1.1754
118 G A -1.1872
119 G A -1.3415
120 G A -1.4039
121 S A -1.2793
122 Q A -1.8416
123 V A 0.0000
124 Q A -1.4362
125 L A 0.0000
126 V A 0.2514
127 Q A 0.0000
128 S A -0.5058
129 G A -0.5822
130 A A -0.0027
131 E A 0.0547
132 V A 0.9817
133 Q A -0.7230
134 K A -1.9997
135 P A -1.9824
136 G A -1.4108
137 A A -1.1259
138 S A -1.1814
139 V A 0.0000
140 K A -1.5179
141 V A 0.0000
142 S A -0.5417
143 C A 0.0000
144 K A -0.9028
145 A A 0.0000
146 S A -0.9008
147 G A -1.1373
148 Y A -0.8084
149 T A -0.8550
150 F A 0.0000
151 N A -2.1924
152 R A -2.4221
153 Y A -1.2676
154 T A -0.6312
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.2279
161 A A -0.6767
162 P A -0.7359
163 G A -1.1236
164 Q A -0.9638
165 L A 0.0000
166 L A -0.1729
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.3727
171 I A 0.0000
172 N A -0.6446
173 P A 0.0000
174 S A -1.7280
175 R A -1.6223
176 G A -0.4994
177 Y A 1.0246
178 Y A 1.1522
179 N A -0.4800
180 Y A -1.3402
181 A A -1.9629
182 Q A -2.8963
183 K A -2.9160
184 F A 0.0000
185 K A -3.2548
186 D A -3.0564
187 R A -2.1348
188 V A 0.0000
189 T A -0.8922
190 M A 0.0000
191 T A -0.3162
192 R A -1.5109
193 D A -1.2667
194 T A -0.9222
195 S A -0.5743
196 T A -0.6734
197 S A -0.9200
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7377
201 M A 0.0000
202 E A -1.2806
203 L A 0.0000
204 S A -1.1771
205 S A -1.1965
206 L A 0.0000
207 R A -2.4928
208 S A -2.1036
209 E A -2.3547
210 D A 0.0000
211 T A -0.7639
212 A A -0.2711
213 V A 0.1276
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1077
221 D A -2.4459
222 D A -2.4931
223 H A -1.4024
224 Y A -0.5056
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.1435
229 W A -0.2025
230 G A 0.0000
231 Q A -0.8582
232 G A -0.3044
233 T A 0.0000
234 T A 0.0368
235 V A 0.0000
236 T A -0.2162
237 V A 0.0000
238 S A -0.7768
239 S A -0.9131
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6656 1.9178 View CSV PDB
4.5 -0.7077 1.9215 View CSV PDB
5.0 -0.7566 1.9313 View CSV PDB
5.5 -0.8041 1.9527 View CSV PDB
6.0 -0.8419 1.9874 View CSV PDB
6.5 -0.8645 2.0309 View CSV PDB
7.0 -0.872 2.0783 View CSV PDB
7.5 -0.869 2.127 View CSV PDB
8.0 -0.8597 2.1759 View CSV PDB
8.5 -0.8444 2.2244 View CSV PDB
9.0 -0.8218 2.2711 View CSV PDB