Project name: AAVA_R5

Status: done

Started: 2026-08-21 04:29:28
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/82ad3e89decde88/tmp/folded.pdb                (00:02:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:22)
Show buried residues

Minimal score value
-2.7078
Maximal score value
2.007
Average score
-0.5677
Total score value
-140.7953

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6987
2 V A 0.0000
3 Q A -2.0582
4 L A 0.0000
5 Q A -1.8545
6 E A 0.0000
7 S A -0.6943
8 G A -0.3793
9 P A 0.0336
10 G A 0.3815
11 L A 0.9711
12 V A 0.0000
13 K A -1.8251
14 P A -1.3601
15 S A -1.4697
16 Q A -2.0576
17 T A -1.6657
18 L A 0.0000
19 S A -0.8873
20 L A 0.0000
21 T A -0.6012
22 A A 0.0000
23 T A -1.2479
24 V A 0.0000
25 S A -1.3923
26 G A -1.4245
27 G A -1.1021
28 S A -0.7345
29 I A 0.0000
30 S A -0.2544
31 S A -0.2687
32 G A 0.0486
33 D A 0.2100
34 Y A 0.7172
35 Y A 0.5949
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.4116
41 Q A 0.0000
42 P A -0.8012
43 P A -0.6712
44 G A -1.1105
45 C A -1.2069
46 K A -2.1234
47 G A -1.3406
48 L A 0.0000
49 E A -0.8256
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1309
54 I A 0.0000
55 Y A 0.3050
56 Y A 0.3028
57 S A -0.0469
58 G A -0.2348
59 S A -0.2657
60 T A -0.2548
61 D A -0.7217
62 Y A -0.7014
63 N A -0.8773
64 P A -1.1440
65 S A -1.0920
66 L A 0.0000
67 K A -2.0961
68 S A -1.4810
69 R A -1.7200
70 V A 0.0000
71 T A -0.9354
72 M A 0.0000
73 S A -0.1940
74 V A -0.3210
75 D A -1.1840
76 T A -1.0306
77 S A -1.3521
78 K A -2.1814
79 N A -1.4644
80 Q A -1.2647
81 F A 0.0000
82 S A -0.3803
83 L A 0.0000
84 K A -1.1453
85 V A 0.0000
86 N A -1.9930
87 S A -1.5971
88 V A 0.0000
89 T A -0.7113
90 A A -0.4215
91 A A -0.2900
92 D A 0.0000
93 T A 0.2721
94 A A 0.0000
95 V A 0.1925
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7902
103 I A 1.5862
104 F A 2.0070
105 G A 0.6792
106 V A 0.5260
107 G A 0.5075
108 T A 0.0000
109 F A 0.0000
110 D A -0.6190
111 Y A -0.6347
112 W A -0.8477
113 G A 0.0000
114 Q A -1.6162
115 G A -0.7589
116 T A -0.2052
117 L A 0.8280
118 V A 0.0000
119 T A 0.3559
120 V A 0.0000
121 S A -0.3767
122 S A -0.7997
123 A A -0.6507
124 A A -0.3661
125 G A -0.8424
126 G A -1.0889
127 G A -1.1574
128 G A -1.1983
129 S A -1.0229
130 G A -1.1723
131 G A -1.2071
132 G A -1.4492
133 G A -1.2234
134 S A -0.8776
135 G A -1.2242
136 G A -1.1380
137 G A -1.2222
138 G A -1.1938
139 S A -0.7435
140 D A -0.6320
141 I A 0.0042
142 V A 1.0018
143 M A 0.0000
144 T A -0.5977
145 Q A -0.6720
146 S A -0.7254
147 P A -0.3099
148 A A -0.2900
149 T A -0.4118
150 L A -0.1967
151 S A -0.7002
152 L A -1.0546
153 S A -1.6112
154 P A -1.8546
155 G A -1.7820
156 E A -2.4428
157 R A -2.7078
158 A A 0.0000
159 T A -0.6771
160 L A 0.0000
161 S A -0.9278
162 V A 0.0000
163 R A -2.3706
164 A A 0.0000
165 S A -0.8240
166 Q A -1.5392
167 S A -1.2282
168 V A 0.0000
169 S A -0.4861
170 S A -0.2519
171 Y A 0.7332
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.1559
179 P A -0.6751
180 G A -0.8713
181 C A -1.0275
182 Q A -1.4229
183 A A -1.1237
184 P A 0.0000
185 R A -1.5634
186 L A -0.7488
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4530
190 D A -0.6366
191 A A 0.0000
192 S A -1.1070
193 N A -1.6255
194 R A -1.6785
195 A A -1.0787
196 T A -0.6479
197 G A -0.6785
198 I A 0.0000
199 P A -0.4502
200 A A -0.3801
201 R A -0.6550
202 F A 0.0000
203 S A -0.7317
204 G A -0.8055
205 S A -0.8964
206 G A -1.2219
207 S A -0.8239
208 G A -1.0945
209 T A -1.8214
210 D A -2.3113
211 F A 0.0000
212 T A -0.8196
213 L A 0.0000
214 T A -0.5862
215 I A 0.0000
216 S A -1.3513
217 S A -1.7358
218 L A 0.0000
219 E A -2.1174
220 P A -1.8148
221 E A -2.1049
222 D A 0.0000
223 F A -0.7839
224 A A 0.0000
225 V A -0.3759
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.0382
233 S A -0.1991
234 T A -0.3554
235 P A -0.4077
236 L A 0.0000
237 T A 0.1910
238 F A 0.2377
239 G A 0.0000
240 G A -0.8171
241 G A -0.7236
242 T A 0.0000
243 K A -0.7019
244 A A 0.0000
245 E A -1.1645
246 I A -1.5046
247 K A -1.7605
248 A A -0.8562
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5273 4.9104 View CSV PDB
4.5 -0.5481 4.9068 View CSV PDB
5.0 -0.5725 4.8974 View CSV PDB
5.5 -0.595 4.8776 View CSV PDB
6.0 -0.6094 4.8466 View CSV PDB
6.5 -0.6112 4.8087 View CSV PDB
7.0 -0.6006 4.7677 View CSV PDB
7.5 -0.5816 4.7258 View CSV PDB
8.0 -0.5579 4.6835 View CSV PDB
8.5 -0.5311 4.6412 View CSV PDB
9.0 -0.5016 4.5992 View CSV PDB