Project name: HS_212

Status: done

Started: 2026-03-20 01:18:30
Chain sequence(s) A: EVQLQQSGAELVRSGASFKLSCTASGFNIKGYYIHWVKQRPEQGLEWIGWIDPENDDTEYAPRFQGKATMTADTSSNTAYLQLTSLTSEDTAVYYCNARQLGSGYFDYWGQGTTLTVSS
B: QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKLWIYATSILASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQQWRSNPFTFGSGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:49)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:46:38)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:46:39)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:46:40)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:46:41)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:46:43)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:46:44)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:46:45)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:46:46)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:46:47)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:46:48)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:46:49)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:46:50)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:46:51)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:46:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:46:58)
Show buried residues

Minimal score value
-3.9577
Maximal score value
1.7052
Average score
-0.5903
Total score value
-133.3973

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.1131
2 V A -1.6329
3 Q A -1.8730
4 L A 0.0000
5 Q A -1.7011
6 Q A -1.0835
7 S A -0.9658
8 G A -0.8455
9 A A -0.1804
10 E A -0.2463
11 L A 0.7992
12 V A 0.0000
13 R A -1.8564
14 S A -1.4755
15 G A -1.1921
16 A A 0.0000
17 S A -1.0621
18 F A 0.0000
19 K A -1.7714
20 L A 0.0000
21 S A -0.5397
22 C A 0.0000
23 T A -0.8197
24 A A 0.0000
25 S A -0.9937
26 G A -1.0829
27 F A 0.0000
28 N A -1.6522
29 I A -1.3791
30 K A -2.3389
31 G A -1.6016
32 Y A 0.0000
33 Y A 0.0000
34 I A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A 0.0000
39 Q A 0.0000
40 R A -1.8958
41 P A -1.8169
42 E A -2.4949
43 Q A -1.8195
44 G A -1.0857
45 L A 0.0000
46 E A -0.7581
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 W A 0.0000
51 I A 0.0000
52 D A 0.0000
53 P A -2.8280
54 E A -3.6446
55 N A -3.4704
56 D A -3.9577
57 D A -3.0208
58 T A -1.7119
59 E A -1.0522
60 Y A -0.4146
61 A A -0.6489
62 P A -0.9481
63 R A -1.2237
64 F A 0.0000
65 Q A -0.9546
66 G A -0.9054
67 K A -0.7566
68 A A 0.0000
69 T A -0.4479
70 M A -0.0419
71 T A -0.0942
72 A A -0.7300
73 D A -1.6143
74 T A 0.0000
75 S A -1.0703
76 S A -0.9316
77 N A -0.9993
78 T A -0.5836
79 A A 0.0000
80 Y A 0.0474
81 L A 0.0000
82 Q A -1.1469
83 L A 0.0000
84 T A -0.8790
85 S A -0.8262
86 L A 0.0000
87 T A -1.1154
88 S A -1.1040
89 E A -1.2951
90 D A -1.6632
91 T A -0.9680
92 A A 0.0000
93 V A -0.3868
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 N A 0.0000
98 A A 0.0000
99 R A 0.0000
100 Q A -0.0998
101 L A 1.1732
102 G A 0.2926
103 S A 0.0219
104 G A 0.4096
105 Y A 0.0000
106 F A 0.7400
107 D A 0.0276
108 Y A -0.5429
109 W A -0.3136
110 G A 0.0000
111 Q A -0.8806
112 G A -0.9002
113 T A 0.0000
114 T A -0.0640
115 L A 0.0000
116 T A 0.0038
117 V A -0.4665
118 S A -0.9206
119 S A -0.9338
1 Q B -0.9433
2 I B 0.0000
3 V B 1.0721
4 L B 0.0000
5 S B -0.5459
6 Q B 0.0000
7 S B -0.3093
8 P B 0.0000
9 A B 0.9021
10 I B 1.7052
11 L B 0.4387
12 S B -0.4388
13 A B 0.0000
14 S B -2.0421
15 P B -1.8462
16 G B -1.3703
17 E B -1.9926
18 K B -2.1908
19 V B 0.0000
20 T B -0.7258
21 M B 0.0000
22 T B -0.5876
23 C B 0.0000
24 R B -1.6483
25 A B 0.0000
26 S B -0.2767
27 S B -0.1953
28 S B -0.2249
29 V B -0.1951
30 S B -0.1359
31 Y B 0.5443
32 M B 0.3191
33 H B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 Q B 0.0000
37 Q B 0.0000
38 K B -2.1898
39 P B -1.7119
40 G B -1.2509
41 S B 0.0000
42 S B -0.8344
43 P B 0.0000
44 K B -1.0931
45 L B 0.0000
46 W B 0.0000
47 I B 0.0000
48 Y B 0.7154
49 A B 0.3757
50 T B 0.1953
51 S B 0.1516
52 I B 0.7806
53 L B 0.4886
54 A B 0.0765
55 S B -0.5630
56 G B -0.4977
57 V B 0.0606
58 P B 0.0000
59 A B -0.8995
60 R B -1.8341
61 F B 0.0000
62 S B -0.6457
63 G B -0.3382
64 S B -0.2809
65 G B -0.6807
66 S B -0.7922
67 G B -0.8812
68 T B -0.6885
69 S B -0.9110
70 Y B -0.3815
71 S B 0.0000
72 L B 0.0000
73 T B -1.0492
74 I B 0.0000
75 S B -1.4513
76 R B 0.0000
77 V B -0.9157
78 E B -2.4762
79 A B -1.4438
80 E B -1.9460
81 D B -2.9722
82 A B -1.5668
83 A B 0.0000
84 T B 0.0000
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 Q B 0.0000
89 Q B 0.0000
90 W B 0.0000
91 R B -0.6575
92 S B -0.3415
93 N B 0.0000
94 P B -0.6982
95 F B 0.0000
96 T B 0.0000
97 F B 0.2285
98 G B -0.1305
99 S B -0.3692
100 G B -0.2383
101 T B 0.0000
102 K B -0.2066
103 L B 0.0000
104 E B -2.0661
105 I B -2.6947
106 K B -3.3877
107 R B -3.3772
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5903 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_6 -0.5903 View CSV PDB
model_10 -0.605 View CSV PDB
input -0.6457 View CSV PDB
model_2 -0.6541 View CSV PDB
model_9 -0.6546 View CSV PDB
model_7 -0.6593 View CSV PDB
model_8 -0.6645 View CSV PDB
model_11 -0.665 View CSV PDB
CABS_average -0.6689 View CSV PDB
model_3 -0.6728 View CSV PDB
model_4 -0.6897 View CSV PDB
model_5 -0.6948 View CSV PDB
model_0 -0.7269 View CSV PDB
model_1 -0.7501 View CSV PDB