Project name: 8371482718ebe2e

Status: done

Started: 2026-03-10 19:35:50
Chain sequence(s) A: MDDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSIAEAAAKEAAAKAFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:19)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8371482718ebe2e/tmp/folded.pdb                (00:05:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:06)
Show buried residues

Minimal score value
-5.409
Maximal score value
4.183
Average score
-0.951
Total score value
-311.9233

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.5217
2 D A -2.4386
3 D A -3.2146
4 R A -2.6013
5 F A -0.6086
6 N A -2.1791
7 D A -1.7620
8 V A 0.5350
9 N A -0.6650
10 T A -0.3123
11 I A 0.4917
12 N A -1.9910
13 K A -2.8695
14 K A -2.9711
15 Q A -2.4553
16 F A -1.0000
17 T A -1.7738
18 E A -2.7625
19 E A -2.8141
20 E A -1.8260
21 F A -0.6255
22 S A -1.2614
23 R A -1.7826
24 L A 0.3427
25 I A 1.1881
26 N A -0.3662
27 S A -0.4183
28 M A 0.5848
29 L A 0.7359
30 K A -1.5517
31 E A -2.2264
32 Y A -0.4592
33 I A -0.6434
34 E A -3.7898
35 D A -4.5819
36 N A -4.4158
37 K A -5.0329
38 K A -5.4018
39 D A -5.4090
40 K A -4.6232
41 H A -3.3237
42 P A -2.2485
43 T A -1.9290
44 Q A -2.2858
45 K A -2.4322
46 T A -1.5554
47 T A -1.2572
48 P A -1.4434
49 K A -2.0009
50 P A -1.2374
51 T A -0.9842
52 T A -1.0556
53 P A -1.2235
54 K A -2.0528
55 Q A -1.6633
56 I A -0.2228
57 N A -1.8029
58 D A -2.3042
59 G A -1.7233
60 T A -1.7737
61 S A -1.9594
62 D A -2.8501
63 K A -2.9602
64 T A -1.9946
65 S A -1.9612
66 D A -2.4538
67 T A -1.2807
68 H A -1.3087
69 T A -0.5405
70 I A 0.3874
71 K A -1.7947
72 R A -2.2497
73 T A -1.4890
74 T A -1.3702
75 P A -1.4386
76 K A -2.0006
77 P A -1.2397
78 T A -0.9745
79 T A -1.0520
80 P A -1.2184
81 K A -2.0845
82 Q A -1.6995
83 I A -0.1908
84 N A -1.8507
85 D A -2.3302
86 G A -1.7332
87 T A -1.7548
88 S A -2.0126
89 D A -2.8530
90 K A -2.9790
91 T A -1.9721
92 S A -1.9572
93 D A -2.4710
94 T A -1.2858
95 H A -1.3026
96 T A -0.5409
97 I A 0.3725
98 K A -1.7936
99 R A -2.2368
100 T A -1.4766
101 T A -1.3631
102 P A -1.4544
103 K A -2.0021
104 P A -1.2407
105 T A -1.0170
106 T A -1.0603
107 P A -1.2142
108 K A -2.0345
109 Q A -1.6939
110 I A -0.2694
111 N A -1.8341
112 D A -2.3100
113 G A -1.7576
114 T A -1.6902
115 S A -2.0346
116 D A -3.1169
117 K A -3.2081
118 P A -2.1823
119 K A -2.0273
120 S A -0.1330
121 I A 2.3012
122 A A 1.9532
123 D A 1.2746
124 I A 3.5605
125 F A 4.1830
126 L A 3.3051
127 I A 2.5071
128 N A -0.8070
129 K A -1.9918
130 P A -1.7074
131 K A -2.0535
132 V A 0.5167
133 P A 1.1133
134 L A 2.3010
135 W A 2.6323
136 I A 2.9011
137 V A 3.0063
138 N A 1.7558
139 P A 2.0683
140 L A 2.6728
141 Y A 2.4945
142 Y A 2.4169
143 M A 2.1819
144 V A 2.8609
145 E A 0.7701
146 K A 0.8757
147 F A 2.9736
148 V A 2.6843
149 Q A 1.1367
150 I A 2.3039
151 M A 2.5317
152 G A 1.6091
153 Y A 1.9501
154 L A 1.6125
155 L A 0.7589
156 E A -1.7000
157 D A -2.7664
158 D A -3.3772
159 D A -2.9318
160 T A -1.1450
161 L A 0.2148
162 E A -0.8558
163 L A 0.6500
164 N A -0.7999
165 L A 0.4882
166 P A 0.1959
167 K A -0.5013
168 Y A 1.3537
169 Y A 1.9384
170 Y A 1.2832
171 D A -0.3868
172 K A -1.2962
173 S A -0.3675
174 I A 1.1487
175 A A -0.4642
176 E A -1.9341
177 A A -1.1840
178 A A -1.1122
179 A A -1.6155
180 K A -2.8273
181 E A -3.1478
182 A A -2.0067
183 A A -1.6825
184 A A -1.9313
185 K A -2.4519
186 A A -1.3715
187 F A -1.0099
188 D A -2.1512
189 A A -1.7797
190 S A -2.1564
191 N A -2.4092
192 F A 0.0000
193 K A -2.2145
194 D A -1.1903
195 F A -0.4278
196 S A -0.5784
197 S A -1.0614
198 I A 0.0000
199 A A -0.3726
200 S A -0.5107
201 A A -0.5279
202 S A -0.6235
203 S A 0.0000
204 S A 0.0153
205 W A 0.0000
206 Q A -0.7544
207 N A 0.0000
208 Q A -1.7361
209 S A -1.3165
210 G A -1.1507
211 S A 0.0000
212 T A -0.6572
213 M A 0.0000
214 I A -0.0031
215 I A 0.0000
216 Q A -1.4329
217 V A 0.0000
218 D A -0.6589
219 S A 0.3602
220 F A 1.0992
221 G A 0.0000
222 N A -1.2347
223 V A 0.0000
224 S A -1.1694
225 G A -0.8008
226 Q A -0.8580
227 Y A 0.0000
228 V A 0.0000
229 N A 0.0000
230 R A -2.3383
231 A A -1.8201
232 Q A -1.9135
233 G A -1.3908
234 T A -1.1435
235 G A -1.5262
236 C A 0.0000
237 Q A -2.6517
238 N A -2.2303
239 S A -1.5990
240 P A -1.1329
241 Y A 0.0000
242 P A -0.9190
243 L A 0.0000
244 T A -1.0062
245 G A -1.2774
246 R A -2.0001
247 V A 0.0000
248 N A -0.9996
249 G A -0.6817
250 T A 0.0541
251 F A 1.1325
252 I A 0.0000
253 A A -0.4467
254 F A 0.0000
255 S A -0.6722
256 V A 0.0000
257 G A -1.1133
258 W A 0.0000
259 N A -2.6907
260 N A -1.8352
261 S A -1.2402
262 T A -1.6091
263 E A -2.6357
264 N A -2.8442
265 C A -1.9429
266 N A -2.3256
267 S A -1.1034
268 A A -0.5783
269 T A 0.0000
270 G A -0.7036
271 W A 0.0000
272 T A -0.1081
273 G A 0.0000
274 Y A 1.0777
275 A A 0.0000
276 Q A -1.0929
277 V A -1.4684
278 N A -1.9671
279 G A -1.6613
280 N A -2.3785
281 N A -1.7526
282 T A 0.0000
283 E A -0.7167
284 I A 0.0000
285 V A 0.2223
286 T A 0.0000
287 S A -1.0395
288 W A -1.2310
289 N A -1.5234
290 L A -0.6472
291 A A -0.3342
292 Y A -0.8142
293 E A -1.9625
294 G A -1.1054
295 G A -1.0985
296 S A -0.9216
297 G A -1.0955
298 P A -0.7689
299 A A -0.1338
300 I A 0.6445
301 E A -1.1319
302 Q A -2.0493
303 G A -1.8812
304 Q A -1.8607
305 D A -1.1587
306 T A -0.7171
307 F A 0.0000
308 Q A -0.6523
309 Y A 0.1461
310 V A 0.5629
311 P A -0.2820
312 T A -0.6888
313 T A -1.5466
314 E A -3.0569
315 N A -2.8317
316 K A -2.3389
317 S A -0.8652
318 L A 0.8275
319 L A 0.7106
320 K A -1.5774
321 D A -2.5922
322 T A -2.0580
323 H A -2.7285
324 H A -2.7014
325 H A -2.6753
326 H A -2.6668
327 H A -2.3831
328 H A -1.8802
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4317 8.0751 View CSV PDB
4.5 -0.5295 7.9782 View CSV PDB
5.0 -0.6425 7.8734 View CSV PDB
5.5 -0.7453 7.7658 View CSV PDB
6.0 -0.8112 7.6574 View CSV PDB
6.5 -0.8275 7.5489 View CSV PDB
7.0 -0.8034 7.4413 View CSV PDB
7.5 -0.7561 7.3363 View CSV PDB
8.0 -0.695 7.2389 View CSV PDB
8.5 -0.6201 7.1595 View CSV PDB
9.0 -0.5291 7.1087 View CSV PDB