Project name: 105-105-10

Status: done

Started: 2026-02-24 07:17:46
Chain sequence(s) A: QVQLVESGGGVVQPGKSLRLSCAASGFTFSKYAIHWVRQAPGKGLEWMAVISYDGDNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREPSLLWSGAYRDYYGVDIWGQGTTVAVSS
B: DVVMTQSPLSLPVTLGQPASISCRSSQSLVSSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:00)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/852ee39379d0229/tmp/folded.pdb                (00:04:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:48)
Show buried residues

Minimal score value
-2.614
Maximal score value
1.3476
Average score
-0.6805
Total score value
-162.6439

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.3335
2 V A -0.6104
3 Q A -0.7921
4 L A 0.0000
5 V A 0.2653
6 E A 0.0000
7 S A -0.5831
8 G A -0.9314
9 G A -0.3116
10 G A 0.4167
11 V A 1.3476
12 V A -0.1443
13 Q A -1.4089
14 P A -1.9532
15 G A -2.1100
16 K A -2.4017
17 S A -1.9428
18 L A -1.1264
19 R A -1.8762
20 L A 0.0000
21 S A -0.4674
22 C A 0.0000
23 A A -0.2694
24 A A 0.0000
25 S A -0.6823
26 G A -0.8863
27 F A -0.4367
28 T A -0.4136
29 F A 0.0000
30 S A -1.3813
31 K A -1.0156
32 Y A -0.2785
33 A A 0.0000
34 I A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.7848
40 A A -1.2038
41 P A -0.9986
42 G A -1.4659
43 K A -2.3753
44 G A -1.5609
45 L A 0.0000
46 E A -1.0166
47 W A 0.0000
48 M A 0.0000
49 A A 0.0000
50 V A 0.0000
51 I A 0.0000
52 S A 0.0000
53 Y A -1.1493
54 D A -2.4837
55 G A -2.0922
56 D A -2.6140
57 N A -1.5898
58 K A -1.0851
59 Y A -0.4511
60 Y A -0.9502
61 A A -1.3235
62 D A -2.4528
63 S A -1.5295
64 V A 0.0000
65 K A -2.5514
66 G A -1.7317
67 R A -1.4538
68 F A 0.0000
69 T A -0.8994
70 I A 0.0000
71 S A -0.8802
72 R A -1.3724
73 D A -1.7901
74 N A -2.0242
75 S A -1.5945
76 K A -2.3855
77 N A -1.7669
78 T A -1.0930
79 L A 0.0000
80 Y A -0.4944
81 L A 0.0000
82 Q A -1.2329
83 M A 0.0000
84 N A -1.8091
85 S A -1.7194
86 L A 0.0000
87 R A -2.4914
88 A A -1.7122
89 E A -2.2406
90 D A 0.0000
91 T A -0.5862
92 A A 0.0000
93 V A 0.1727
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.0742
99 E A 0.0000
100 P A -0.0405
101 S A 0.0377
102 L A 0.1433
103 L A 0.0000
104 W A -0.1395
105 S A -1.0066
106 G A -0.8205
107 A A -0.7325
108 Y A -0.6356
109 R A -1.7977
110 D A -1.4069
111 Y A 0.0000
112 Y A -0.2345
113 G A 0.0000
114 V A 0.0000
115 D A -0.3622
116 I A -0.0453
117 W A 0.0000
118 G A 0.0000
119 Q A -1.2358
120 G A 0.0000
121 T A -0.2554
122 T A 0.1657
123 V A 0.0000
124 A A 0.1277
125 V A 0.0000
126 S A -0.6761
127 S A -0.3686
1 D B -1.4842
2 V B 0.0000
3 V B 0.6349
4 M B 0.0000
5 T B -0.5670
6 Q B 0.0000
7 S B -0.3478
8 P B -0.0038
9 L B 0.4913
10 S B -0.2132
11 L B -0.4541
12 P B -1.0803
13 V B 0.0000
14 T B -0.7541
15 L B -0.3818
16 G B -1.0043
17 Q B -1.5563
18 P B -1.5804
19 A B 0.0000
20 S B -0.7240
21 I B 0.0000
22 S B -0.9411
23 C B 0.0000
24 R B -2.3830
25 S B 0.0000
26 S B -1.0051
27 Q B -1.5363
28 S B -0.8578
29 L B 0.0000
30 V B 0.4538
31 S B -0.4813
32 S B -1.0020
33 D B -1.9381
34 G B -1.1811
35 N B -0.9111
36 T B -0.2973
37 Y B 0.0000
38 L B 0.0000
39 N B 0.0000
40 W B 0.0000
41 F B 0.0000
42 Q B 0.0000
43 Q B 0.0000
44 R B -1.4678
45 P B -1.0325
46 G B -1.2347
47 Q B -1.7276
48 S B -1.3156
49 P B 0.0000
50 R B -1.8537
51 R B 0.0000
52 L B 0.0000
53 I B 0.0000
54 Y B -0.6316
55 K B -0.9692
56 V B -0.7346
57 S B -1.0383
58 N B -1.4823
59 R B -1.6244
60 D B -1.3140
61 S B -0.7572
62 G B -0.8872
63 V B -1.0699
64 P B -1.2618
65 D B -2.1794
66 R B -1.8767
67 F B 0.0000
68 S B -1.2576
69 G B -0.8449
70 S B -0.8784
71 G B -1.1369
72 S B -0.8038
73 G B -0.7486
74 T B -1.5828
75 D B -2.3441
76 F B 0.0000
77 T B -1.0431
78 L B 0.0000
79 K B -1.4423
80 I B 0.0000
81 S B -1.9171
82 R B -2.1521
83 V B 0.0000
84 E B -1.0561
85 A B -0.6552
86 E B -1.6193
87 D B 0.0000
88 V B -0.7514
89 G B 0.0000
90 V B -0.3056
91 Y B 0.0000
92 Y B 0.0000
93 C B 0.0000
94 M B 0.0000
95 Q B 0.0000
96 G B 0.0000
97 T B -0.2895
98 H B -0.5763
99 W B -0.1499
100 P B -0.4681
101 P B 0.0000
102 T B -0.1263
103 F B 0.0479
104 G B 0.0000
105 Q B -1.1776
106 G B 0.0000
107 T B 0.0000
108 K B -0.8650
109 V B 0.0000
110 E B -1.4892
111 I B -0.4245
112 K B -1.5538
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6431 1.8401 View CSV PDB
4.5 -0.6837 1.7534 View CSV PDB
5.0 -0.7319 1.6355 View CSV PDB
5.5 -0.7795 1.5012 View CSV PDB
6.0 -0.8176 1.364 View CSV PDB
6.5 -0.84 1.2331 View CSV PDB
7.0 -0.847 1.1577 View CSV PDB
7.5 -0.8438 1.2041 View CSV PDB
8.0 -0.834 1.3257 View CSV PDB
8.5 -0.8183 1.4861 View CSV PDB
9.0 -0.7954 1.6468 View CSV PDB