Project name: 85a716412ad3d96

Status: done

Started: 2026-03-09 07:25:58
Chain sequence(s) A: DAKTTQPPSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVLDNYGQNFVFGPGTRLSVLPGGGSEGGGSEGGGSEGGGSEGGTGEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSLGLTGQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:45)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/85a716412ad3d96/tmp/folded.pdb                (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:28)
Show buried residues

Minimal score value
-3.6854
Maximal score value
1.3735
Average score
-0.7803
Total score value
-191.9623

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.7814
2 A A -1.0947
3 K A -0.9735
4 T A 0.0000
5 T A -0.6664
6 Q A -0.7625
7 P A -0.6756
8 P A -0.8137
9 S A -1.2383
10 M A -1.3288
11 D A -2.0435
12 C A 0.0000
13 A A -1.3246
14 E A -1.7917
15 G A -1.7121
16 R A -2.6720
17 A A -1.6115
18 A A 0.0000
19 N A -1.2834
20 L A 0.0000
21 P A -0.5368
22 C A 0.0000
23 N A -1.4740
24 H A 0.0000
25 S A -1.2772
26 T A -0.6353
27 I A -0.9750
28 S A -0.9323
29 G A -1.3723
30 N A -1.7520
31 E A -1.0635
32 Y A -0.5373
33 V A 0.0000
34 Y A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 R A -0.7164
38 Q A -0.8192
39 I A -0.9718
40 H A -1.0959
41 S A -1.2421
42 Q A -1.1967
43 G A -0.6519
44 P A 0.0000
45 Q A -0.8567
46 Y A -0.1920
47 I A 0.0000
48 I A 0.0000
49 H A -0.6059
50 G A 0.0000
51 L A -1.5182
52 K A -3.3607
53 N A -3.0733
54 N A -2.6724
55 E A -2.1804
56 T A -1.4238
57 N A -1.5236
58 E A -1.9306
59 M A -0.8285
60 A A 0.0000
61 S A -0.8144
62 L A 0.0000
63 I A -0.8124
64 I A 0.0000
65 T A -2.3411
66 E A -3.5442
67 D A -3.3748
68 R A -2.8553
69 K A -2.4940
70 S A -1.6103
71 S A 0.0000
72 T A -0.2928
73 L A 0.0000
74 I A -0.0869
75 L A 0.0000
76 P A -1.3117
77 H A -1.8417
78 A A 0.0000
79 T A -1.0833
80 L A -0.1763
81 R A -1.5298
82 D A -0.9405
83 T A -0.9366
84 A A 0.0000
85 V A -0.6813
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 I A 0.0000
90 V A 0.0000
91 L A 0.0000
92 D A -0.6523
93 N A -0.4689
94 Y A 0.5230
95 G A -0.0861
96 Q A -0.3460
97 N A -0.6300
98 F A 0.0000
99 V A -0.4035
100 F A 0.0000
101 G A 0.0000
102 P A -0.9970
103 G A 0.0000
104 T A 0.0000
105 R A -2.1030
106 L A 0.0000
107 S A -1.1576
108 V A 0.0000
109 L A -0.0471
110 P A -0.3505
111 G A -1.1217
112 G A -1.2198
113 G A -1.4626
114 S A -1.6575
115 E A -2.5005
116 G A -1.8031
117 G A -1.4605
118 G A -1.4549
119 S A -1.5539
120 E A -2.3563
121 G A -1.7361
122 G A -1.3940
123 G A -1.3425
124 S A -1.5348
125 E A -2.4219
126 G A -1.8472
127 G A -1.6597
128 G A -1.8062
129 S A -1.7125
130 E A -2.5071
131 G A -1.8214
132 G A -1.6907
133 T A -1.3340
134 G A -1.7070
135 E A -2.2486
136 A A -1.2391
137 G A -0.9983
138 V A 0.0000
139 A A -0.2014
140 Q A 0.0000
141 S A -0.5405
142 P A -0.7801
143 R A -1.4864
144 Y A -0.1585
145 K A 0.0735
146 I A 1.1402
147 I A 0.0000
148 E A -2.7421
149 K A -3.4799
150 R A -3.6854
151 Q A -3.1758
152 S A -2.2180
153 V A 0.0000
154 A A -0.4994
155 F A 0.0000
156 W A 0.1459
157 C A 0.0000
158 N A -0.1061
159 P A 0.0000
160 I A 0.0000
161 S A -0.1761
162 G A -0.3070
163 H A -0.0241
164 A A -0.5790
165 T A 0.0000
166 L A 0.0000
167 Y A 0.0000
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A -0.1081
172 I A 0.3716
173 L A 1.2688
174 G A -0.3608
175 Q A -1.0361
176 G A -0.6269
177 P A 0.0000
178 K A -1.0901
179 L A 0.0000
180 L A 0.0000
181 I A 0.0000
182 Q A 0.0000
183 F A 0.0000
184 Q A -0.9751
185 N A -1.8683
186 N A -1.8681
187 G A -0.3756
188 V A 1.1302
189 V A 1.3735
190 D A 0.0542
191 D A -0.7462
192 S A -1.0867
193 Q A -1.6851
194 L A 0.0000
195 P A -1.9033
196 K A -3.0921
197 D A -2.9654
198 R A -2.3883
199 F A 0.0000
200 S A -1.6462
201 A A -0.6465
202 E A -0.9792
203 R A 0.0000
204 L A -0.3658
205 K A -1.5433
206 G A -1.2733
207 V A 0.4383
208 D A -0.0330
209 S A 0.0000
210 T A -0.2856
211 L A 0.0000
212 K A -1.2424
213 I A 0.0000
214 Q A -2.8728
215 P A -2.8511
216 A A 0.0000
217 K A -2.1145
218 L A -0.5356
219 E A -1.3842
220 D A 0.0000
221 S A 0.0255
222 A A 0.0000
223 V A 0.0544
224 Y A 0.0000
225 L A 0.0000
226 C A 0.0000
227 A A 0.0000
228 S A 0.0000
229 S A 0.0000
230 L A 0.9201
231 G A 0.4161
232 L A 0.6317
233 T A 0.4460
234 G A 0.0000
235 Q A 0.0000
236 Y A 0.4785
237 F A 0.0672
238 G A 0.0000
239 P A -0.8332
240 G A 0.0000
241 T A 0.0000
242 R A -1.0008
243 L A 0.0000
244 T A -0.0153
245 V A 0.0000
246 T A -0.8114
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6349 2.2574 View CSV PDB
4.5 -0.6852 2.2167 View CSV PDB
5.0 -0.745 2.1666 View CSV PDB
5.5 -0.8034 2.1151 View CSV PDB
6.0 -0.8483 2.0703 View CSV PDB
6.5 -0.8711 2.0397 View CSV PDB
7.0 -0.8724 2.0242 View CSV PDB
7.5 -0.8594 2.0181 View CSV PDB
8.0 -0.838 2.0161 View CSV PDB
8.5 -0.81 2.0154 View CSV PDB
9.0 -0.7758 2.0152 View CSV PDB