Project name: 468718088117aa1 [mutate: GS35A, AS49A, AS75A, KR87A] [mutate: AP14A, RY59A, HN84A] [mutate: YR59A] [mutate: MT78A, PA88A, QL120A] [mutate: RY59A]

Status: done

Started: 2026-03-06 12:43:18
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGRTFSSYAMSWFRQAPGKEREFVSAISRSAGTTRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAATLQSTVVLSTHNYDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Mutated residues RY59A
Energy difference between WT (input) and mutated protein (by FoldX) -0.710596 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       FoldX:    Building mutant model                                                       (00:02:59)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:26)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:31:37)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:31:38)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:31:38)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:31:39)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:31:40)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:31:41)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:31:42)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:31:43)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:31:44)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:31:44)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:31:45)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:31:46)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:31:47)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:31:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:31:55)
Show buried residues

Minimal score value
-2.3224
Maximal score value
1.9723
Average score
-0.1153
Total score value
-14.4088

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8199
2 V A 0.0000
3 Q A -1.1983
4 L A 0.0000
5 V A 0.9096
6 E A -0.0303
7 S A -0.1954
8 G A -0.2774
9 G A -0.5862
10 G A -0.5548
11 L A 0.0000
12 V A 1.7656
13 Q A 0.0000
14 P A -0.1462
15 G A -0.5385
16 G A -0.5897
17 S A -0.4108
18 L A 0.0000
19 R A -1.8964
20 L A 0.0000
21 S A -0.0027
22 C A 0.0000
23 A A 0.0313
24 A A 0.0000
25 S A -0.1771
26 G A -0.7080
27 R A -1.9075
28 T A 0.0000
29 F A 0.0000
30 S A -0.1673
31 S A -0.0611
32 Y A 0.0000
33 A A 0.0000
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 F A 0.5037
38 R A 0.0000
39 Q A -0.6182
40 A A 0.0000
41 P A -0.4227
42 G A -0.6615
43 K A -1.2239
44 E A -2.3224
45 R A -2.2455
46 E A 0.0000
47 F A 1.9723
48 V A 0.0000
49 S A 0.0000
50 A A 0.0145
51 I A 0.0000
52 S A 0.0000
53 R A -0.2560
54 S A -0.1556
55 A A -0.0649
56 G A -0.4615
57 T A -0.1144
58 T A 0.1533
59 Y A 1.1405 mutated: RY59A
60 Y A 1.4952
61 A A 0.1626
62 D A -0.7696
63 S A 0.1242
64 V A 1.7618
65 K A 0.0000
66 G A -0.6697
67 R A -1.9045
68 F A 0.0000
69 T A -0.0567
70 I A 0.0000
71 S A -0.0760
72 R A -0.2269
73 D A 0.0000
74 N A -0.8364
75 S A -0.6865
76 K A -1.8406
77 N A -0.8544
78 T A -0.1150
79 L A 0.0000
80 Y A 0.4968
81 L A 0.0000
82 Q A -0.6386
83 M A 0.0000
84 N A -0.6859
85 S A 0.0000
86 L A 1.5477
87 R A 0.0000
88 A A 0.0585
89 E A 0.0000
90 D A -1.7932
91 T A -0.3542
92 A A 0.0000
93 V A 0.3714
94 Y A 0.0000
95 Y A 0.0700
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 A A 0.0000
100 T A 0.0304
101 L A 0.0371
102 Q A -1.1615
103 S A -0.2943
104 T A 0.2684
105 V A 1.8674
106 V A 1.4788
107 L A 1.1774
108 S A 0.1325
109 T A -0.2285
110 H A -1.1286
111 N A -0.6561
112 Y A 1.0779
113 D A -0.2821
114 Y A 0.0000
115 W A 1.1640
116 G A 0.1151
117 Q A -0.5881
118 G A -0.3303
119 T A 0.2416
120 L A 1.5462
121 V A 0.0000
122 T A 0.1505
123 V A 0.1655
124 S A -0.1979
125 S A -0.2508
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.1153 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
input -0.1153 View CSV PDB
model_1 -0.1355 View CSV PDB
model_10 -0.1448 View CSV PDB
model_11 -0.1489 View CSV PDB
model_3 -0.1582 View CSV PDB
model_2 -0.1598 View CSV PDB
model_4 -0.1621 View CSV PDB
model_7 -0.1657 View CSV PDB
CABS_average -0.1694 View CSV PDB
model_9 -0.1733 View CSV PDB
model_5 -0.1782 View CSV PDB
model_0 -0.1898 View CSV PDB
model_6 -0.1944 View CSV PDB
model_8 -0.2217 View CSV PDB