Project name: 8775ece98673228

Status: done

Started: 2026-07-15 06:00:17
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVYCKASGGTFRSYGLNWVRQAPGQGLEWMGRIVPIFGISNFAQKFQGRFTITADRSANTPYMELSSLRSEDTAVYYCVRGGAVAGAGSAGEGIFDYWDQGTLVIVSS
B: EIVMTQSPATLSVSPGERATLSCRASQSVSNNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDSAVYYCQQHHSWPPFTFGQGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:04)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:04)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:04)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:04)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:12:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8775ece98673228/tmp/folded.pdb                (00:12:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:22:56)
Show buried residues

Minimal score value
-3.1177
Maximal score value
2.4894
Average score
-0.616
Total score value
-144.135

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.4346
2 V A 1.1653
3 Q A 0.4546
4 L A 1.8240
5 V A 1.7393
6 Q A -0.3046
7 S A -0.4079
8 G A -0.5050
9 A A -0.0475
10 E A 0.1309
11 V A 1.1350
12 K A -0.7817
13 K A -2.0586
14 P A -2.2549
15 G A -1.6109
16 S A -1.3138
17 S A -1.2963
18 V A 0.0000
19 K A -1.2186
20 V A 0.0000
21 Y A 0.3445
22 C A 0.0000
23 K A -0.8871
24 A A -0.6161
25 S A -1.0283
26 G A -1.7169
27 G A -1.5222
28 T A -0.7722
29 F A 0.0000
30 R A -2.7696
31 S A -0.7705
32 Y A 0.0512
33 G A 0.0000
34 L A 0.0000
35 N A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.4977
40 A A -0.8725
41 P A -0.9595
42 G A -1.2175
43 Q A -1.8814
44 G A -1.3420
45 L A 0.0000
46 E A -0.6752
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 R A 0.0000
51 I A 0.5846
52 V A 0.0000
53 P A 0.0000
54 I A 1.0315
55 F A 2.4894
56 G A 0.9690
57 I A 1.3838
58 S A 0.4815
59 N A -0.1701
60 F A -0.7154
61 A A 0.0000
62 Q A -2.6361
63 K A -2.6942
64 F A 0.0000
65 Q A -2.3874
66 G A -1.6246
67 R A -1.3654
68 F A 0.0000
69 T A -0.7012
70 I A 0.0000
71 T A -0.6032
72 A A 0.0000
73 D A -2.9173
74 R A -3.1177
75 S A -2.1302
76 A A -2.0357
77 N A -2.1708
78 T A -1.0627
79 P A 0.0000
80 Y A -0.2431
81 M A 0.0000
82 E A -1.1439
83 L A 0.0000
84 S A -1.0658
85 S A -1.1735
86 L A 0.0000
87 R A -2.8956
88 S A -2.2464
89 E A -2.4637
90 D A 0.0000
91 T A -0.5149
92 A A 0.0000
93 V A 0.4784
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 V A 0.0000
98 R A -0.5013
99 G A 0.0000
100 G A -0.5272
101 A A -0.1180
102 V A -0.0886
103 A A -0.1600
104 G A -0.5577
105 A A -0.5169
106 G A -0.7629
107 S A -0.7224
108 A A -0.6855
109 G A 0.0000
110 E A -0.6283
111 G A 0.0000
112 I A 0.0000
113 F A 0.0000
114 D A -0.6859
115 Y A -0.3488
116 W A 0.0000
117 D A 0.0000
118 Q A -1.5281
119 G A -0.6804
120 T A 0.0000
121 L A 0.7852
122 V A 0.0000
123 I A 0.4213
124 V A 0.0000
125 S A -0.6209
126 S A -1.1190
1 E B -1.6562
2 I B 0.0000
3 V B 0.6407
4 M B 0.0000
5 T B -0.7738
6 Q B 0.0000
7 S B -0.7681
8 P B -0.3255
9 A B -0.5052
10 T B -0.5987
11 L B -0.5123
12 S B -0.8784
13 V B 0.0000
14 S B -1.7942
15 P B -1.8460
16 G B -2.0337
17 E B -2.9861
18 R B -3.0355
19 A B 0.0000
20 T B -0.5378
21 L B 0.0000
22 S B -0.9857
23 C B 0.0000
24 R B -2.6088
25 A B 0.0000
26 S B -1.1048
27 Q B -1.8015
28 S B -1.6529
29 V B 0.0000
30 S B -1.2768
31 N B -1.5521
32 N B -0.8816
33 L B 0.0000
34 A B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.7397
40 P B -1.1402
41 G B -1.4801
42 Q B -2.1211
43 A B -1.3862
44 P B 0.0000
45 R B -1.5063
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B -0.3205
50 G B -0.6853
51 A B 0.0000
52 S B -0.7822
53 T B -0.5953
54 R B -0.9963
55 A B -0.7400
56 T B -0.5124
57 G B -0.5582
58 I B -0.5169
59 P B -0.3635
60 A B -0.3771
61 R B -0.7691
62 F B 0.0000
63 S B -0.5370
64 G B -0.5067
65 S B -0.9186
66 G B -1.5293
67 S B -1.6225
68 G B -1.6521
69 T B -2.2546
70 E B -3.0311
71 F B 0.0000
72 T B -0.9466
73 L B 0.0000
74 T B -0.6403
75 I B 0.0000
76 S B -1.7128
77 S B -1.9178
78 L B 0.0000
79 Q B -2.0587
80 S B -1.7545
81 E B -2.2773
82 D B 0.0000
83 S B -1.3708
84 A B 0.0000
85 V B -0.7454
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 H B 0.0000
92 H B -0.7605
93 S B -0.6858
94 W B -0.3281
95 P B -0.5706
96 P B 0.0000
97 F B 0.0000
98 T B 0.0000
99 F B 0.0963
100 G B 0.0000
101 Q B -1.4152
102 G B 0.0000
103 T B 0.0000
104 K B -1.5038
105 L B 0.0000
106 E B -1.7354
107 I B -1.3566
108 K B -1.7094
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.64 5.1642 View CSV PDB
4.5 -0.6701 5.1642 View CSV PDB
5.0 -0.7071 5.1642 View CSV PDB
5.5 -0.7429 5.1642 View CSV PDB
6.0 -0.7695 5.1642 View CSV PDB
6.5 -0.7807 5.1642 View CSV PDB
7.0 -0.775 5.1642 View CSV PDB
7.5 -0.7574 5.1642 View CSV PDB
8.0 -0.7332 5.1642 View CSV PDB
8.5 -0.7053 5.1641 View CSV PDB
9.0 -0.6752 5.164 View CSV PDB