Project name: 8ab125aef70270a

Status: done

Started: 2026-03-10 18:39:22
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTAEAAAKEAAAKADDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:26)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8ab125aef70270a/tmp/folded.pdb                (00:05:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:46)
Show buried residues

Minimal score value
-5.1801
Maximal score value
3.6412
Average score
-0.983
Total score value
-322.4389

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1783
2 H A -1.3844
3 H A -2.0997
4 H A -2.5557
5 H A -2.6244
6 H A -2.5284
7 H A -2.1609
8 F A -1.5423
9 D A -2.2525
10 A A -1.7921
11 S A -2.0363
12 N A -2.3267
13 F A 0.0000
14 K A -2.3683
15 D A -1.5652
16 F A 0.0000
17 S A -0.8954
18 S A -1.2520
19 I A 0.0000
20 A A -0.6143
21 S A -0.9130
22 A A -1.0172
23 S A -0.6453
24 S A 0.0000
25 S A -0.0261
26 W A 0.0000
27 Q A -0.8558
28 N A 0.0000
29 Q A -1.6969
30 S A -1.1977
31 G A -1.0614
32 S A 0.0000
33 T A -0.6473
34 M A 0.0000
35 I A 0.0200
36 I A 0.0000
37 Q A -1.5846
38 V A 0.0000
39 D A -0.9194
40 S A 0.2176
41 F A 1.0407
42 G A -0.7376
43 N A -1.3586
44 V A 0.0000
45 S A -1.2679
46 G A -0.7794
47 Q A -0.7793
48 Y A 0.0000
49 V A 0.0000
50 N A 0.0000
51 R A -1.7213
52 A A -1.4813
53 Q A -1.7380
54 G A -1.2752
55 T A -0.9843
56 G A -1.3045
57 C A 0.0000
58 Q A -1.7730
59 N A -1.7579
60 S A -1.2248
61 P A -0.9493
62 Y A 0.0000
63 P A -0.8351
64 L A 0.0000
65 T A -1.0316
66 G A -1.3615
67 R A -1.9748
68 V A -1.0130
69 N A -1.1880
70 G A -0.9626
71 T A -0.2994
72 F A 0.8044
73 I A 0.0000
74 A A -0.3716
75 F A 0.0000
76 S A -0.5855
77 V A 0.0000
78 G A -1.1539
79 W A 0.0000
80 N A -2.6280
81 N A -1.6858
82 S A -1.1085
83 T A -1.3579
84 E A -2.2231
85 N A -2.7509
86 C A -1.8652
87 N A -2.2372
88 S A -0.9766
89 A A -0.2725
90 T A 0.0000
91 G A -0.5399
92 W A 0.0000
93 T A -0.0617
94 G A 0.0000
95 Y A 1.1242
96 A A 0.0000
97 Q A -0.6489
98 V A -1.1685
99 N A -1.7503
100 G A -1.6548
101 N A -2.1821
102 N A -1.6679
103 T A 0.0000
104 E A 0.0000
105 I A 0.0000
106 V A 0.3584
107 T A 0.0000
108 S A -0.8544
109 W A -1.0295
110 N A -1.1394
111 L A -0.1250
112 A A -0.0483
113 Y A -0.5045
114 E A -1.8583
115 G A -1.1293
116 G A -1.0615
117 S A -0.9095
118 G A -1.0442
119 P A -0.6523
120 A A 0.0328
121 I A 0.8298
122 E A -0.9396
123 Q A -1.8649
124 G A -1.6788
125 Q A -1.6758
126 D A 0.0000
127 T A -0.6068
128 F A 0.0000
129 Q A -0.7933
130 Y A 0.0379
131 V A 0.4562
132 P A -0.4858
133 T A -0.8480
134 T A -1.5850
135 E A -3.1119
136 N A -2.8642
137 K A -2.4546
138 S A -1.4501
139 L A 0.1005
140 L A -0.5325
141 K A -2.5110
142 D A -2.4937
143 T A -1.4191
144 A A -1.8427
145 E A -3.4122
146 A A -2.5030
147 A A -1.9865
148 A A -2.2934
149 K A -3.2131
150 E A -3.4283
151 A A -2.5191
152 A A -2.5431
153 A A -2.9154
154 K A -3.6959
155 A A -2.9236
156 D A -3.6955
157 D A -4.1213
158 R A -3.6394
159 F A -1.5587
160 N A -2.8574
161 D A -2.6697
162 V A -0.7862
163 N A -1.1994
164 T A -0.2586
165 I A 0.3447
166 N A -1.8925
167 K A -2.7472
168 K A -2.6303
169 Q A -1.9770
170 F A 0.2635
171 T A -1.0222
172 E A -2.0503
173 E A -2.3205
174 E A -1.0449
175 F A 0.6467
176 S A -1.1086
177 R A -1.6920
178 L A 0.2654
179 I A 0.5227
180 N A -0.9102
181 S A -0.4264
182 M A 0.2963
183 L A 0.4083
184 K A -1.8696
185 E A -2.5568
186 Y A -0.6245
187 I A -1.2296
188 E A -3.9549
189 D A -4.3891
190 N A -4.0357
191 K A -4.9985
192 K A -5.1801
193 D A -5.0238
194 K A -4.2678
195 H A -3.2047
196 P A -2.0140
197 T A -1.7331
198 Q A -2.2763
199 K A -2.4163
200 T A -1.5197
201 T A -1.2740
202 P A -1.4004
203 K A -1.9963
204 P A -1.2238
205 T A -0.9457
206 T A -1.0276
207 P A -1.2102
208 K A -2.0631
209 Q A -1.6304
210 I A -0.1489
211 N A -1.7850
212 D A -2.3016
213 G A -1.5184
214 T A -1.2094
215 S A -1.6798
216 D A -2.7571
217 K A -2.8887
218 T A -1.8670
219 S A -1.6662
220 D A -2.3933
221 T A -1.2648
222 H A -1.2245
223 T A -0.5076
224 I A 0.3901
225 K A -1.7847
226 R A -2.2226
227 T A -1.4690
228 T A -1.3651
229 P A -1.4019
230 K A -1.9964
231 P A -1.2206
232 T A -0.9432
233 T A -1.0422
234 P A -1.1995
235 K A -2.0589
236 Q A -1.6389
237 I A -0.1670
238 N A -1.7919
239 D A -2.2872
240 G A -1.5214
241 T A -1.2157
242 S A -1.6968
243 D A -2.7595
244 K A -2.8910
245 T A -1.8528
246 S A -1.6778
247 D A -2.3854
248 T A -1.2631
249 H A -1.2151
250 T A -0.5169
251 I A 0.3783
252 K A -1.7840
253 R A -2.2141
254 T A -1.4790
255 T A -1.3862
256 P A -1.4115
257 K A -1.9980
258 P A -1.2254
259 T A -0.9541
260 T A -1.0544
261 P A -1.2094
262 K A -2.0524
263 Q A -1.6547
264 I A -0.1932
265 N A -1.7916
266 D A -2.2919
267 G A -1.6972
268 T A -1.5666
269 S A -1.9166
270 D A -3.0539
271 K A -3.0876
272 P A -1.4612
273 K A -1.9950
274 S A 0.2052
275 I A 2.5784
276 A A 2.2294
277 D A 1.7666
278 I A 3.2848
279 F A 3.6412
280 L A 3.2220
281 I A 2.5821
282 N A -0.2414
283 K A -1.5603
284 P A -1.4158
285 K A -1.9317
286 V A 0.2229
287 P A 1.0178
288 L A 2.0369
289 W A 2.1740
290 I A 2.0964
291 V A 1.9591
292 N A 0.9850
293 P A 1.3404
294 L A 2.0630
295 Y A 2.1172
296 Y A 1.9310
297 M A 1.9651
298 V A 1.8109
299 E A 0.1908
300 K A 0.5809
301 F A 2.4019
302 V A 1.8297
303 Q A 0.9692
304 I A 2.8362
305 M A 2.3968
306 G A 1.7000
307 Y A 2.5089
308 L A 2.5912
309 L A 0.9436
310 E A -1.9065
311 D A -3.2701
312 D A -3.5641
313 D A -3.0429
314 T A -1.3519
315 L A 0.1331
316 E A -0.7581
317 L A 0.8526
318 N A -0.4532
319 L A 0.8739
320 P A 0.1849
321 K A -0.4900
322 Y A 1.4299
323 Y A 1.5802
324 Y A 0.7233
325 D A -1.1784
326 K A -1.5503
327 S A -0.4437
328 I A 1.1955
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4174 7.1193 View CSV PDB
4.5 -0.5133 7.0964 View CSV PDB
5.0 -0.6269 7.0829 View CSV PDB
5.5 -0.7303 7.0915 View CSV PDB
6.0 -0.7961 7.1255 View CSV PDB
6.5 -0.8105 7.1761 View CSV PDB
7.0 -0.7829 7.2343 View CSV PDB
7.5 -0.7331 7.2957 View CSV PDB
8.0 -0.6725 7.3597 View CSV PDB
8.5 -0.6022 7.4278 View CSV PDB
9.0 -0.5189 7.501 View CSV PDB