Project name: HSA6A9_prot3D_74_015M

Status: done

Started: 2026-02-25 09:10:12
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQTYDWHTRSWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGSPRGGMDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:04)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8c783f333683521/tmp/folded.pdb                (00:02:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:02)
Show buried residues

Minimal score value
-2.853
Maximal score value
1.5159
Average score
-0.5763
Total score value
-132.5558

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.1869
2 S A 0.0048
3 V A 1.4182
4 L A 0.0000
5 T A 0.0948
6 Q A 0.0000
7 P A -0.3811
8 P A -0.5649
9 S A -0.4176
11 V A -0.0108
12 S A -0.0979
13 G A 0.0000
14 A A -0.1946
15 P A -0.9331
16 G A -1.7930
17 Q A -2.5531
18 R A -2.6731
19 V A 0.0000
20 T A -0.5155
21 I A 0.0000
22 S A -0.2387
23 C A 0.0000
24 T A -0.1792
25 G A 0.0000
26 S A -0.0869
27 S A -0.4830
28 S A -0.4895
29 N A 0.0000
30 I A 0.0000
31 G A -0.8375
35 A A -0.3067
36 G A -0.5154
37 Y A 0.0413
38 D A -0.4898
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A 0.0000
44 Q A 0.0000
45 L A -0.2954
46 P A -0.4536
47 G A -0.4338
48 T A -0.4732
49 A A -0.5600
50 P A 0.0000
51 K A -1.3150
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -1.1654
56 G A -1.1997
57 N A -1.0336
65 S A -1.2856
66 N A -1.9331
67 R A -2.0588
68 P A -1.1713
69 S A -0.7850
70 G A -0.8460
71 V A -0.7945
72 P A -1.3009
74 D A -2.1983
75 R A -1.5218
76 F A 0.0000
77 S A -0.9844
78 G A -0.7923
79 S A -0.6518
80 K A -1.0512
83 S A -0.8332
84 G A -0.9447
85 T A -0.7281
86 S A -0.6494
87 A A 0.0000
88 S A -0.4249
89 L A 0.0000
90 A A -0.5783
91 I A 0.0000
92 T A -1.8973
93 G A -1.8074
94 L A 0.0000
95 Q A -1.4909
96 A A -1.1674
97 E A -2.1327
98 D A 0.0000
99 E A -1.3269
100 A A 0.0000
101 D A -0.6283
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 T A 0.0000
107 Y A -0.0090
108 D A 0.0000
109 W A -0.4534
110 H A -1.2664
113 T A -1.4297
114 R A -1.7841
115 S A 0.0000
116 W A 0.0000
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.5007
121 G A 0.0000
122 T A 0.0000
123 K A -0.6566
124 V A 0.0000
125 T A 0.1350
126 V A 0.4352
127 L A 1.4911
1 Q B -0.8001
2 V B 0.3781
3 Q B -0.1892
4 L B 0.0000
5 V B 0.6539
6 Q B -0.0117
7 S B -0.6875
8 G B -0.8539
9 G B -0.5572
11 G B 0.4294
12 V B 1.5159
13 V B 0.1296
14 Q B -1.5828
15 P B -2.3077
16 G B -2.2276
17 R B -2.8530
18 S B -2.1717
19 L B -1.2560
20 R B -2.0882
21 L B 0.0000
22 S B -0.5357
23 C B 0.0000
24 A B -0.1956
25 A B -0.1361
26 S B -0.2475
27 G B -0.2612
28 F B 0.0526
29 T B -0.4881
30 F B -0.3967
35 S B 0.0184
36 S B 0.4238
37 Y B 0.6831
38 G B 0.3930
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.7581
45 A B -1.0424
46 P B -0.9591
47 G B -1.4696
48 K B -2.2220
49 G B -1.4264
50 L B 0.0000
51 E B -0.7582
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.2215
58 Y B 0.4547
59 D B -1.5341
62 G B -0.8178
63 S B -0.7919
64 N B -0.6012
65 K B -0.6278
66 Y B -0.3407
67 Y B -0.9973
68 A B 0.0000
69 D B -2.6783
70 S B -1.9824
71 V B 0.0000
72 K B -2.5481
74 G B -1.7610
75 R B -1.7088
76 F B 0.0000
77 T B -0.7962
78 I B 0.0000
79 S B -0.7387
80 R B -1.2736
81 D B -1.7201
82 N B -1.8758
83 S B -1.6361
84 K B -2.3057
85 N B -1.5964
86 T B -1.0033
87 L B 0.0000
88 Y B -0.5240
89 L B 0.0000
90 Q B -1.2038
91 M B 0.0000
92 N B -2.2763
93 S B -2.0679
94 L B 0.0000
95 R B -2.8253
96 A B -1.7215
97 E B -2.0133
98 D B 0.0000
99 T B -0.3943
100 A B 0.0000
101 V B 0.1396
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4800
107 D B 0.0000
108 G B -0.7507
109 S B -0.7505
110 P B -1.0401
112 R B -1.9666
113 G B -1.4317
114 G B 0.0000
115 M B 0.0000
116 D B -1.2385
117 V B -0.5172
118 W B 0.0000
119 G B 0.0000
120 Q B -0.9586
121 G B -0.4752
122 T B 0.0000
123 T B 0.0665
124 V B 0.0000
125 T B 0.2998
126 V B -0.7007
127 S B -0.4366
128 S B -0.4823
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5813 2.3639 View CSV PDB
4.5 -0.6106 2.3453 View CSV PDB
5.0 -0.6431 2.3227 View CSV PDB
5.5 -0.6734 2.2998 View CSV PDB
6.0 -0.6957 2.2802 View CSV PDB
6.5 -0.7062 2.2671 View CSV PDB
7.0 -0.7074 2.2607 View CSV PDB
7.5 -0.7038 2.2582 View CSV PDB
8.0 -0.6974 2.2573 View CSV PDB
8.5 -0.6876 2.2571 View CSV PDB
9.0 -0.673 2.257 View CSV PDB